Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-responsive element-binding protein 1

Gene

RREB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1.6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri208 – 230C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri235 – 258C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri316 – 338C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri643 – 665C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri671 – 693C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri699 – 722C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri753 – 775C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri790 – 815C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1246 – 1268C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1393 – 1415C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1512 – 1534C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1540 – 1562C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ92766
SIGNORiQ92766

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-responsive element-binding protein 1
Short name:
RREB-1
Alternative name(s):
Finger protein in nuclear bodies
Raf-responsive zinc finger protein LZ321
Zinc finger motif enhancer-binding protein 1
Short name:
Zep-1
Gene namesi
Name:RREB1
Synonyms:FINB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000124782.19
HGNCiHGNC:10449 RREB1
MIMi602209 gene
neXtProtiNX_Q92766

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6239
MalaCardsiRREB1
OpenTargetsiENSG00000124782
Orphaneti567 22q11.2 deletion syndrome
PharmGKBiPA34864

Polymorphism and mutation databases

BioMutaiRREB1
DMDMi152031673

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000473261 – 1687Ras-responsive element-binding protein 1Add BLAST1687

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei36PhosphoserineCombined sources1
Modified residuei42PhosphoserineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei180PhosphoserineCombined sources1
Cross-linki203Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei231PhosphoserineCombined sources1
Cross-linki435Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki502Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki566Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki593Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki613Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki624Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki857Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki885Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki913Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei970PhosphoserineBy similarity1
Modified residuei1122PhosphoserineCombined sources1
Modified residuei1134PhosphoserineBy similarity1
Modified residuei1135PhosphoserineBy similarity1
Modified residuei1140PhosphoserineCombined sources1
Modified residuei1167PhosphoserineCombined sources1
Modified residuei1174PhosphoserineCombined sources1
Modified residuei1175PhosphoserineCombined sources1
Modified residuei1219PhosphoserineCombined sources1
Modified residuei1225PhosphoserineCombined sources1
Modified residuei1315PhosphothreonineCombined sources1
Modified residuei1320PhosphoserineCombined sources1
Modified residuei1475PhosphoserineCombined sources1
Modified residuei1585PhosphoserineBy similarity1
Modified residuei1598PhosphoserineBy similarity1
Modified residuei1653PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ92766
MaxQBiQ92766
PeptideAtlasiQ92766
PRIDEiQ92766
ProteomicsDBi75450
75451 [Q92766-2]
75452 [Q92766-3]
75453 [Q92766-4]

PTM databases

iPTMnetiQ92766
PhosphoSitePlusiQ92766

Expressioni

Tissue specificityi

Expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not found in the brain.1 Publication

Gene expression databases

BgeeiENSG00000124782 Expressed in 230 organ(s), highest expression level in epithelium of mammary gland
ExpressionAtlasiQ92766 baseline and differential
GenevisibleiQ92766 HS

Organism-specific databases

HPAiHPA001756
HPA034843

Interactioni

Subunit structurei

Interacts with NEUROD1 and AR.2 Publications

Protein-protein interaction databases

BioGridi112153, 19 interactors
CORUMiQ92766
IntActiQ92766, 18 interactors

Structurei

3D structure databases

ProteinModelPortaliQ92766
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi481 – 546Pro-richAdd BLAST66
Compositional biasi877 – 880Poly-Pro4
Compositional biasi969 – 1064Pro-richAdd BLAST96

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri208 – 230C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri235 – 258C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri316 – 338C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri643 – 665C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri671 – 693C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri699 – 722C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri753 – 775C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri790 – 815C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1246 – 1268C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1393 – 1415C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1512 – 1534C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1540 – 1562C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00930000150976
HOVERGENiHBG108418
InParanoidiQ92766
KOiK20210
OMAiCSPDTVC
OrthoDBiEOG091G0AFV
PhylomeDBiQ92766
TreeFamiTF332503

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92766-1) [UniParc]FASTAAdd to basket
Also known as: beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSSSPAGLE GSDLSSINTM MSAVMSVGKV TENGGSPQGI KSPSKPPGPN
60 70 80 90 100
RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHSCS
110 120 130 140 150
ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD
160 170 180 190 200
PNSATATAPP SPLKRRRLSS KRKLSHDAES EREDPAPAKK MVEDGQSGDL
210 220 230 240 250
EKKADEVFHC PVCFKEFVCK YGLETHMETH SDNPLRCDIC CVTFRTHRGL
260 270 280 290 300
LRHNALVHKQ LPRDAMGRPF IQNNPSIPAG FHDLGFTDFS CRKFPRISQA
310 320 330 340 350
WCETNLRRCI SEQHRFVCDT CDKAFPMLCS LALHKQTHVA ADQGQEKPQA
360 370 380 390 400
TPLPGDALDQ KGFLALLGLQ HTKDVRPAPA EEPLPDDNQA IQLQTLKCQL
410 420 430 440 450
PQDPGCTNLL SLSPFEAASL GGSLTVLPAT KDSIKHLSLQ PFQKGFIIQP
460 470 480 490 500
DSSIVVKPIS GESAIELADI QQILKMAASA PPQISLPPFS KAPAAPLQAI
510 520 530 540 550
FKHMPPLKPK PLVTPRTVVA TSTPPPLINA QQASPGCISP SLPPPPLKLL
560 570 580 590 600
KGSVEAASNA HLLQSKSGTQ PHAATRLSLQ QPRAELPGQP EMKTQLEQDS
610 620 630 640 650
IIEALLPLSM EAKIKQEITE GELKAFMTAP GGKKTPAMRK VLYPCRFCNQ
660 670 680 690 700
VFAFSGVLRA HVRSHLGISP YQCNICDYIA ADKAALIRHL RTHSGERPYI
710 720 730 740 750
CKICHYPFTV KANCERHLRK KHLKATRKDI EKNIEYVSSS AAELVDAFCA
760 770 780 790 800
PDTVCRLCGE DLKHYRALRI HMRTHCGRGL GGGHKGRKPF ECKECSAAFA
810 820 830 840 850
AKRNCIHHIL KQHLHVPEQD IESYVLAADG LGPAEAPAAE ASGRGEDSGC
860 870 880 890 900
AALGDCKPLT AFLEPQNGFL HRGPTQPPPP HVSIKLEPAS SFAVDFNEPL
910 920 930 940 950
DFSQKGLALV QVKQENISFL SPSSLVPYDC SMEPIDLSIP KNFRKGDKDL
960 970 980 990 1000
ATPSEAKKPE EEAGSSEQPS PCPAPGPSLP VTLGPSGILE SPMAPAPAAT
1010 1020 1030 1040 1050
PEPPAQPLQG PVQLAVPIYS SALVSSPPLV GSSALLSGTA LLRPLRPKPP
1060 1070 1080 1090 1100
LLLPKPPVTE ELPPLASIAQ IISSVSSAPT LLKTKVADPG PASTGSNTTA
1110 1120 1130 1140 1150
SDSLGGSVPK AATTATPAAT TSPKESSEPP APASSPEAAS PTEQGPAGTS
1160 1170 1180 1190 1200
KKRGRKRGMR SRPRANSGGV DLDSSGEFAS IEKMLATTDT NKFSPFLQTA
1210 1220 1230 1240 1250
EDNTQDEVAG APADHHGPSD EEQGSPPEDK LLRAKRNSYT NCLQKITCPH
1260 1270 1280 1290 1300
CPRVFPWASS LQRHMLTHTD SQSDAETAAA AGEVLDLTSR DREQPSEGAT
1310 1320 1330 1340 1350
ELRQVAGDAP VEQATAETAS PVHREEHGRG ESHEPEEEHG TEESTGDADG
1360 1370 1380 1390 1400
AEEDASSNQS LDLDFATKLM DFKLAEGDGE AGAGGAASQE QKLACDTCGK
1410 1420 1430 1440 1450
SFKFLGTLSR HRKAHGRQEP KDEKGDGAST AEEGPQPAPE QEEKPPETPA
1460 1470 1480 1490 1500
EVVESAPGAG EAPAEKLAEE TEGPSDGESA AEKRSSEKSD DDKKPKTDSP
1510 1520 1530 1540 1550
KSVASKADKR KKVCSVCNKR FWSLQDLTRH MRSHTGERPY KCQTCERTFT
1560 1570 1580 1590 1600
LKHSLVRHQR IHQKARHAKH HGKDSDKEER GEEDSENEST HSGNNAVSEN
1610 1620 1630 1640 1650
EAELAPNASN HMAVTRSRKE GLASATKDCS HREEKVTAGW PSEPGQGDLN
1660 1670 1680
PESPAALGQD LLEPRSKRPA HPILATADGA SQLVGME
Length:1,687
Mass (Da):181,420
Last modified:July 10, 2007 - v3
Checksum:i33B5755B0243C64F
GO
Isoform 2 (identifier: Q92766-2) [UniParc]FASTAAdd to basket
Also known as: alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1269: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPQSKESDVGSHDST

Show »
Length:1,742
Mass (Da):187,551
Checksum:i1344C2619E7A7241
GO
Isoform 3 (identifier: Q92766-3) [UniParc]FASTAAdd to basket
Also known as: gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1534: DSQSDAETAA...QDLTRHMRSH → GQKPFPCQKC...KESDVGSHDS

Show »
Length:1,476
Mass (Da):159,331
Checksum:iDB242C01B42D9592
GO
Isoform 4 (identifier: Q92766-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1200: Missing.
     1201-1268: EDNTQDEVAG...SSLQRHMLTH → MLTHTGQKPF...KESDVGSHDS

Show »
Length:478
Mass (Da):51,610
Checksum:i92323DDA34814C60
GO
Isoform 5 (identifier: Q92766-5) [UniParc]FASTAAdd to basket
Also known as: delta

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1535: Missing.

Show »
Length:1,421
Mass (Da):153,200
Checksum:i31241D101F0B5C48
GO
Isoform 6 (identifier: Q92766-6) [UniParc]FASTAAdd to basket
Also known as: epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     300-314: AWCETNLRRCISEQH → GKGHTNVRPASEPSP
     315-1687: Missing.

Show »
Length:314
Mass (Da):34,614
Checksum:iDAD3CC4A2A045F89
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X055A0A087X055_HUMAN
Ras-responsive element-binding prot...
RREB1
755Annotation score:
C9JU34C9JU34_HUMAN
Ras-responsive element-binding prot...
RREB1
778Annotation score:
C9JPJ6C9JPJ6_HUMAN
Ras-responsive element-binding prot...
RREB1
164Annotation score:
C9JE09C9JE09_HUMAN
Ras-responsive element-binding prot...
RREB1
136Annotation score:

Sequence cautioni

The sequence AAB19094 differs from that shown. Reason: Frameshift at positions 908, 1350 and 1383.Curated
The sequence AAC25598 differs from that shown. Reason: Frameshift at positions 1350 and 1383.Curated
The sequence AAC26118 differs from that shown. Reason: Frameshift at positions 1350 and 1383.Curated
Isoform 2 : The sequence AAC26118 differs from that shown. Reason: Frameshift at position 1271.Curated
The sequence AAH42910 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH42910 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA23165 differs from that shown. Numerous sequencing errors.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti574A → T in ADO14469 (PubMed:21703425).Curated1
Sequence conflicti866Q → K in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti994A → V in ADO14469 (PubMed:21703425).Curated1
Sequence conflicti1148G → R in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1321P → R in AAC25598 (PubMed:10390538).Curated1
Sequence conflicti1321P → R in AAC26118 (PubMed:10390538).Curated1
Sequence conflicti1394 – 1395AC → SS in AAC25598 (PubMed:10390538).Curated2
Sequence conflicti1394 – 1395AC → SS in AAC26118 (PubMed:10390538).Curated2
Sequence conflicti1429S → T in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1436Q → S in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1683L → H in AAB19094 (PubMed:8816445).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033197195G → R3 PublicationsCorresponds to variant dbSNP:rs1334576Ensembl.1
Natural variantiVAR_033198783G → V2 PublicationsCorresponds to variant dbSNP:rs9502564Ensembl.1
Natural variantiVAR_0331991171D → N. Corresponds to variant dbSNP:rs9379084Ensembl.1
Natural variantiVAR_0332001384G → R. Corresponds to variant dbSNP:rs2281833Ensembl.1
Natural variantiVAR_0332011467L → P3 PublicationsCorresponds to variant dbSNP:rs2256596Ensembl.1
Natural variantiVAR_0332021499S → Y. Corresponds to variant dbSNP:rs35742417Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0267041 – 1200Missing in isoform 4. 1 PublicationAdd BLAST1200
Alternative sequenceiVSP_053538300 – 314AWCET…ISEQH → GKGHTNVRPASEPSP in isoform 6. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_053539315 – 1687Missing in isoform 6. 1 PublicationAdd BLAST1373
Alternative sequenceiVSP_0267051201 – 1268EDNTQ…HMLTH → MLTHTGQKPFPCQKCDAFFS TKSNCERHQLRKHGVTTCSL RRNGLIPQSKESDVGSHDS in isoform 4. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0267061269T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPQSKESDVGSHDST in isoform 2. 2 Publications1
Alternative sequenceiVSP_0535401270 – 1535Missing in isoform 5. 1 PublicationAdd BLAST266
Alternative sequenceiVSP_0267071270 – 1534DSQSD…HMRSH → GQKPFPCQKCDAFFSTKSNC ERHQLRKHGVTTCSLRRNGL IPQSKESDVGSHDS in isoform 3. 1 PublicationAdd BLAST265

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49835 mRNA Translation: BAA23165.1 Sequence problems.
AB019254 mRNA Translation: BAD32776.1
AB019351 mRNA Translation: BAD32778.1
AB019352 mRNA Translation: BAD32779.1
HM369360 mRNA Translation: ADO14468.1
HM369361 mRNA Translation: ADO14469.1
AL139095 Genomic DNA No translation available.
AL355336 Genomic DNA No translation available.
AL589644 Genomic DNA No translation available.
BC042910 mRNA Translation: AAH42910.1 Sequence problems.
BC131599 mRNA Translation: AAI31600.1
U26914 mRNA Translation: AAB19094.1 Frameshift.
AF072825 mRNA Translation: AAC25598.1 Frameshift.
AF072826 mRNA Translation: AAC26118.1 Frameshift.
CCDSiCCDS34335.1 [Q92766-2]
CCDS34336.1 [Q92766-1]
CCDS54963.1 [Q92766-3]
RefSeqiNP_001003698.1, NM_001003698.3 [Q92766-1]
NP_001003699.1, NM_001003699.3 [Q92766-2]
NP_001003700.1, NM_001003700.1 [Q92766-3]
NP_001161816.1, NM_001168344.1 [Q92766-1]
XP_006715220.1, XM_006715157.3
XP_011513097.1, XM_011514795.2
UniGeneiHs.298248

Genome annotation databases

EnsembliENST00000334984; ENSP00000335574; ENSG00000124782 [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782 [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782 [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782 [Q92766-2]
GeneIDi6239
KEGGihsa:6239
UCSCiuc003mxb.4 human [Q92766-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49835 mRNA Translation: BAA23165.1 Sequence problems.
AB019254 mRNA Translation: BAD32776.1
AB019351 mRNA Translation: BAD32778.1
AB019352 mRNA Translation: BAD32779.1
HM369360 mRNA Translation: ADO14468.1
HM369361 mRNA Translation: ADO14469.1
AL139095 Genomic DNA No translation available.
AL355336 Genomic DNA No translation available.
AL589644 Genomic DNA No translation available.
BC042910 mRNA Translation: AAH42910.1 Sequence problems.
BC131599 mRNA Translation: AAI31600.1
U26914 mRNA Translation: AAB19094.1 Frameshift.
AF072825 mRNA Translation: AAC25598.1 Frameshift.
AF072826 mRNA Translation: AAC26118.1 Frameshift.
CCDSiCCDS34335.1 [Q92766-2]
CCDS34336.1 [Q92766-1]
CCDS54963.1 [Q92766-3]
RefSeqiNP_001003698.1, NM_001003698.3 [Q92766-1]
NP_001003699.1, NM_001003699.3 [Q92766-2]
NP_001003700.1, NM_001003700.1 [Q92766-3]
NP_001161816.1, NM_001168344.1 [Q92766-1]
XP_006715220.1, XM_006715157.3
XP_011513097.1, XM_011514795.2
UniGeneiHs.298248

3D structure databases

ProteinModelPortaliQ92766
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112153, 19 interactors
CORUMiQ92766
IntActiQ92766, 18 interactors

PTM databases

iPTMnetiQ92766
PhosphoSitePlusiQ92766

Polymorphism and mutation databases

BioMutaiRREB1
DMDMi152031673

Proteomic databases

EPDiQ92766
MaxQBiQ92766
PeptideAtlasiQ92766
PRIDEiQ92766
ProteomicsDBi75450
75451 [Q92766-2]
75452 [Q92766-3]
75453 [Q92766-4]

Protocols and materials databases

DNASUi6239
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334984; ENSP00000335574; ENSG00000124782 [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782 [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782 [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782 [Q92766-2]
GeneIDi6239
KEGGihsa:6239
UCSCiuc003mxb.4 human [Q92766-1]

Organism-specific databases

CTDi6239
DisGeNETi6239
EuPathDBiHostDB:ENSG00000124782.19
GeneCardsiRREB1
HGNCiHGNC:10449 RREB1
HPAiHPA001756
HPA034843
MalaCardsiRREB1
MIMi602209 gene
neXtProtiNX_Q92766
OpenTargetsiENSG00000124782
Orphaneti567 22q11.2 deletion syndrome
PharmGKBiPA34864
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00930000150976
HOVERGENiHBG108418
InParanoidiQ92766
KOiK20210
OMAiCSPDTVC
OrthoDBiEOG091G0AFV
PhylomeDBiQ92766
TreeFamiTF332503

Enzyme and pathway databases

SignaLinkiQ92766
SIGNORiQ92766

Miscellaneous databases

ChiTaRSiRREB1 human
GeneWikiiRREB1
GenomeRNAii6239
PROiPR:Q92766
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124782 Expressed in 230 organ(s), highest expression level in epithelium of mammary gland
ExpressionAtlasiQ92766 baseline and differential
GenevisibleiQ92766 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits
ProtoNetiSearch...

Entry informationi

Entry nameiRREB1_HUMAN
AccessioniPrimary (citable) accession number: Q92766
Secondary accession number(s): A2RRF5
, E2GM80, E2GM81, O75567, O75568, Q5VYB2, Q6BEP5, Q6BEP6, Q6BEP8, Q86SU2, Q9Y474
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 10, 2007
Last modified: November 7, 2018
This is version 170 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again