Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (16 Oct 2019)
Sequence version 3 (10 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-responsive element-binding protein 1

Gene

RREB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1.6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri208 – 230C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri235 – 258C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri316 – 338C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri643 – 665C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri671 – 693C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri699 – 722C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri753 – 775C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri790 – 815C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1246 – 1268C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1393 – 1415C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1512 – 1534C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1540 – 1562C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q92766

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92766

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-responsive element-binding protein 1
Short name:
RREB-1
Alternative name(s):
Finger protein in nuclear bodies
Raf-responsive zinc finger protein LZ321
Zinc finger motif enhancer-binding protein 1
Short name:
Zep-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RREB1
Synonyms:FINB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10449 RREB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602209 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92766

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6239

MalaCards human disease database

More...
MalaCardsi
RREB1

Open Targets

More...
OpenTargetsi
ENSG00000124782

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
567 22q11.2 deletion syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34864

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q92766

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RREB1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
152031673

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000473261 – 1687Ras-responsive element-binding protein 1Add BLAST1687

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei36PhosphoserineCombined sources1
Modified residuei42PhosphoserineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei175PhosphoserineCombined sources1
Modified residuei180PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki203Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei231PhosphoserineCombined sources1
Cross-linki435Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki502Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki566Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki593Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki613Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki615Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki624Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki857Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki885Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki913Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei970PhosphoserineBy similarity1
Modified residuei1122PhosphoserineCombined sources1
Modified residuei1134PhosphoserineBy similarity1
Modified residuei1135PhosphoserineBy similarity1
Modified residuei1140PhosphoserineCombined sources1
Modified residuei1167PhosphoserineCombined sources1
Modified residuei1174PhosphoserineCombined sources1
Modified residuei1175PhosphoserineCombined sources1
Modified residuei1219PhosphoserineCombined sources1
Modified residuei1225PhosphoserineCombined sources1
Modified residuei1315PhosphothreonineCombined sources1
Modified residuei1320PhosphoserineCombined sources1
Modified residuei1475PhosphoserineCombined sources1
Modified residuei1585PhosphoserineBy similarity1
Modified residuei1598PhosphoserineBy similarity1
Modified residuei1653PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92766

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92766

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q92766

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92766

PeptideAtlas

More...
PeptideAtlasi
Q92766

PRoteomics IDEntifications database

More...
PRIDEi
Q92766

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75450 [Q92766-1]
75451 [Q92766-2]
75452 [Q92766-3]
75453 [Q92766-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92766

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92766

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q92766

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not found in the brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124782 Expressed in 230 organ(s), highest expression level in epithelium of mammary gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92766 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92766 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001756
HPA034843

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NEUROD1 and AR.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112153, 21 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q92766

Protein interaction database and analysis system

More...
IntActi
Q92766, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369270

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi481 – 546Pro-richAdd BLAST66
Compositional biasi877 – 880Poly-Pro4
Compositional biasi969 – 1064Pro-richAdd BLAST96

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri208 – 230C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri235 – 258C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri316 – 338C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri643 – 665C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri671 – 693C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri699 – 722C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri753 – 775C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri790 – 815C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1246 – 1268C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1393 – 1415C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1512 – 1534C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1540 – 1562C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157533

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92766

KEGG Orthology (KO)

More...
KOi
K20210

Identification of Orthologs from Complete Genome Data

More...
OMAi
IPKNFRR

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92766

TreeFam database of animal gene trees

More...
TreeFami
TF332503

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 15 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 8 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92766-1) [UniParc]FASTAAdd to basket
Also known as: beta

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSSSPAGLE GSDLSSINTM MSAVMSVGKV TENGGSPQGI KSPSKPPGPN
60 70 80 90 100
RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHSCS
110 120 130 140 150
ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD
160 170 180 190 200
PNSATATAPP SPLKRRRLSS KRKLSHDAES EREDPAPAKK MVEDGQSGDL
210 220 230 240 250
EKKADEVFHC PVCFKEFVCK YGLETHMETH SDNPLRCDIC CVTFRTHRGL
260 270 280 290 300
LRHNALVHKQ LPRDAMGRPF IQNNPSIPAG FHDLGFTDFS CRKFPRISQA
310 320 330 340 350
WCETNLRRCI SEQHRFVCDT CDKAFPMLCS LALHKQTHVA ADQGQEKPQA
360 370 380 390 400
TPLPGDALDQ KGFLALLGLQ HTKDVRPAPA EEPLPDDNQA IQLQTLKCQL
410 420 430 440 450
PQDPGCTNLL SLSPFEAASL GGSLTVLPAT KDSIKHLSLQ PFQKGFIIQP
460 470 480 490 500
DSSIVVKPIS GESAIELADI QQILKMAASA PPQISLPPFS KAPAAPLQAI
510 520 530 540 550
FKHMPPLKPK PLVTPRTVVA TSTPPPLINA QQASPGCISP SLPPPPLKLL
560 570 580 590 600
KGSVEAASNA HLLQSKSGTQ PHAATRLSLQ QPRAELPGQP EMKTQLEQDS
610 620 630 640 650
IIEALLPLSM EAKIKQEITE GELKAFMTAP GGKKTPAMRK VLYPCRFCNQ
660 670 680 690 700
VFAFSGVLRA HVRSHLGISP YQCNICDYIA ADKAALIRHL RTHSGERPYI
710 720 730 740 750
CKICHYPFTV KANCERHLRK KHLKATRKDI EKNIEYVSSS AAELVDAFCA
760 770 780 790 800
PDTVCRLCGE DLKHYRALRI HMRTHCGRGL GGGHKGRKPF ECKECSAAFA
810 820 830 840 850
AKRNCIHHIL KQHLHVPEQD IESYVLAADG LGPAEAPAAE ASGRGEDSGC
860 870 880 890 900
AALGDCKPLT AFLEPQNGFL HRGPTQPPPP HVSIKLEPAS SFAVDFNEPL
910 920 930 940 950
DFSQKGLALV QVKQENISFL SPSSLVPYDC SMEPIDLSIP KNFRKGDKDL
960 970 980 990 1000
ATPSEAKKPE EEAGSSEQPS PCPAPGPSLP VTLGPSGILE SPMAPAPAAT
1010 1020 1030 1040 1050
PEPPAQPLQG PVQLAVPIYS SALVSSPPLV GSSALLSGTA LLRPLRPKPP
1060 1070 1080 1090 1100
LLLPKPPVTE ELPPLASIAQ IISSVSSAPT LLKTKVADPG PASTGSNTTA
1110 1120 1130 1140 1150
SDSLGGSVPK AATTATPAAT TSPKESSEPP APASSPEAAS PTEQGPAGTS
1160 1170 1180 1190 1200
KKRGRKRGMR SRPRANSGGV DLDSSGEFAS IEKMLATTDT NKFSPFLQTA
1210 1220 1230 1240 1250
EDNTQDEVAG APADHHGPSD EEQGSPPEDK LLRAKRNSYT NCLQKITCPH
1260 1270 1280 1290 1300
CPRVFPWASS LQRHMLTHTD SQSDAETAAA AGEVLDLTSR DREQPSEGAT
1310 1320 1330 1340 1350
ELRQVAGDAP VEQATAETAS PVHREEHGRG ESHEPEEEHG TEESTGDADG
1360 1370 1380 1390 1400
AEEDASSNQS LDLDFATKLM DFKLAEGDGE AGAGGAASQE QKLACDTCGK
1410 1420 1430 1440 1450
SFKFLGTLSR HRKAHGRQEP KDEKGDGAST AEEGPQPAPE QEEKPPETPA
1460 1470 1480 1490 1500
EVVESAPGAG EAPAEKLAEE TEGPSDGESA AEKRSSEKSD DDKKPKTDSP
1510 1520 1530 1540 1550
KSVASKADKR KKVCSVCNKR FWSLQDLTRH MRSHTGERPY KCQTCERTFT
1560 1570 1580 1590 1600
LKHSLVRHQR IHQKARHAKH HGKDSDKEER GEEDSENEST HSGNNAVSEN
1610 1620 1630 1640 1650
EAELAPNASN HMAVTRSRKE GLASATKDCS HREEKVTAGW PSEPGQGDLN
1660 1670 1680
PESPAALGQD LLEPRSKRPA HPILATADGA SQLVGME
Length:1,687
Mass (Da):181,420
Last modified:July 10, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i33B5755B0243C64F
GO
Isoform 2 (identifier: Q92766-2) [UniParc]FASTAAdd to basket
Also known as: alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1269: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPQSKESDVGSHDST

Show »
Length:1,742
Mass (Da):187,551
Checksum:i1344C2619E7A7241
GO
Isoform 3 (identifier: Q92766-3) [UniParc]FASTAAdd to basket
Also known as: gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1534: DSQSDAETAA...QDLTRHMRSH → GQKPFPCQKC...KESDVGSHDS

Show »
Length:1,476
Mass (Da):159,331
Checksum:iDB242C01B42D9592
GO
Isoform 4 (identifier: Q92766-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1200: Missing.
     1201-1268: EDNTQDEVAG...SSLQRHMLTH → MLTHTGQKPF...KESDVGSHDS

Show »
Length:478
Mass (Da):51,610
Checksum:i92323DDA34814C60
GO
Isoform 5 (identifier: Q92766-5) [UniParc]FASTAAdd to basket
Also known as: delta

The sequence of this isoform differs from the canonical sequence as follows:
     1270-1535: Missing.

Show »
Length:1,421
Mass (Da):153,200
Checksum:i31241D101F0B5C48
GO
Isoform 6 (identifier: Q92766-6) [UniParc]FASTAAdd to basket
Also known as: epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     300-314: AWCETNLRRCISEQH → GKGHTNVRPASEPSP
     315-1687: Missing.

Show »
Length:314
Mass (Da):34,614
Checksum:iDAD3CC4A2A045F89
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X055A0A087X055_HUMAN
Ras-responsive element-binding prot...
RREB1
755Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JU34C9JU34_HUMAN
Ras-responsive element-binding prot...
RREB1
778Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JE09C9JE09_HUMAN
Ras-responsive element-binding prot...
RREB1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JPJ6C9JPJ6_HUMAN
Ras-responsive element-binding prot...
RREB1
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB19094 differs from that shown. Reason: Frameshift.Curated
The sequence AAC25598 differs from that shown. Reason: Frameshift.Curated
The sequence AAC26118 differs from that shown. Reason: Frameshift.Curated
Isoform 2 : The sequence AAC26118 differs from that shown. Reason: Frameshift.Curated
The sequence AAH42910 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH42910 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA23165 differs from that shown. Numerous sequencing errors.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti574A → T in ADO14469 (PubMed:21703425).Curated1
Sequence conflicti866Q → K in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti994A → V in ADO14469 (PubMed:21703425).Curated1
Sequence conflicti1148G → R in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1321P → R in AAC25598 (PubMed:10390538).Curated1
Sequence conflicti1321P → R in AAC26118 (PubMed:10390538).Curated1
Sequence conflicti1394 – 1395AC → SS in AAC25598 (PubMed:10390538).Curated2
Sequence conflicti1394 – 1395AC → SS in AAC26118 (PubMed:10390538).Curated2
Sequence conflicti1429S → T in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1436Q → S in AAB19094 (PubMed:8816445).Curated1
Sequence conflicti1683L → H in AAB19094 (PubMed:8816445).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033197195G → R3 PublicationsCorresponds to variant dbSNP:rs1334576Ensembl.1
Natural variantiVAR_033198783G → V2 PublicationsCorresponds to variant dbSNP:rs9502564Ensembl.1
Natural variantiVAR_0331991171D → N. Corresponds to variant dbSNP:rs9379084Ensembl.1
Natural variantiVAR_0332001384G → R. Corresponds to variant dbSNP:rs2281833Ensembl.1
Natural variantiVAR_0332011467L → P3 PublicationsCorresponds to variant dbSNP:rs2256596Ensembl.1
Natural variantiVAR_0332021499S → Y. Corresponds to variant dbSNP:rs35742417Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0267041 – 1200Missing in isoform 4. 1 PublicationAdd BLAST1200
Alternative sequenceiVSP_053538300 – 314AWCET…ISEQH → GKGHTNVRPASEPSP in isoform 6. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_053539315 – 1687Missing in isoform 6. 1 PublicationAdd BLAST1373
Alternative sequenceiVSP_0267051201 – 1268EDNTQ…HMLTH → MLTHTGQKPFPCQKCDAFFS TKSNCERHQLRKHGVTTCSL RRNGLIPQSKESDVGSHDS in isoform 4. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0267061269T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPQSKESDVGSHDST in isoform 2. 2 Publications1
Alternative sequenceiVSP_0535401270 – 1535Missing in isoform 5. 1 PublicationAdd BLAST266
Alternative sequenceiVSP_0267071270 – 1534DSQSD…HMRSH → GQKPFPCQKCDAFFSTKSNC ERHQLRKHGVTTCSLRRNGL IPQSKESDVGSHDS in isoform 3. 1 PublicationAdd BLAST265

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D49835 mRNA Translation: BAA23165.1 Sequence problems.
AB019254 mRNA Translation: BAD32776.1
AB019351 mRNA Translation: BAD32778.1
AB019352 mRNA Translation: BAD32779.1
HM369360 mRNA Translation: ADO14468.1
HM369361 mRNA Translation: ADO14469.1
AL139095 Genomic DNA No translation available.
AL355336 Genomic DNA No translation available.
AL589644 Genomic DNA No translation available.
BC042910 mRNA Translation: AAH42910.1 Sequence problems.
BC131599 mRNA Translation: AAI31600.1
U26914 mRNA Translation: AAB19094.1 Frameshift.
AF072825 mRNA Translation: AAC25598.1 Frameshift.
AF072826 mRNA Translation: AAC26118.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34335.1 [Q92766-2]
CCDS34336.1 [Q92766-1]
CCDS54963.1 [Q92766-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001003698.1, NM_001003698.3 [Q92766-1]
NP_001003699.1, NM_001003699.3 [Q92766-2]
NP_001003700.1, NM_001003700.1 [Q92766-3]
NP_001161816.1, NM_001168344.1 [Q92766-1]
XP_006715220.1, XM_006715157.3
XP_011513097.1, XM_011514795.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334984; ENSP00000335574; ENSG00000124782 [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782 [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782 [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782 [Q92766-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6239

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6239

UCSC genome browser

More...
UCSCi
uc003mxb.4 human [Q92766-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49835 mRNA Translation: BAA23165.1 Sequence problems.
AB019254 mRNA Translation: BAD32776.1
AB019351 mRNA Translation: BAD32778.1
AB019352 mRNA Translation: BAD32779.1
HM369360 mRNA Translation: ADO14468.1
HM369361 mRNA Translation: ADO14469.1
AL139095 Genomic DNA No translation available.
AL355336 Genomic DNA No translation available.
AL589644 Genomic DNA No translation available.
BC042910 mRNA Translation: AAH42910.1 Sequence problems.
BC131599 mRNA Translation: AAI31600.1
U26914 mRNA Translation: AAB19094.1 Frameshift.
AF072825 mRNA Translation: AAC25598.1 Frameshift.
AF072826 mRNA Translation: AAC26118.1 Frameshift.
CCDSiCCDS34335.1 [Q92766-2]
CCDS34336.1 [Q92766-1]
CCDS54963.1 [Q92766-3]
RefSeqiNP_001003698.1, NM_001003698.3 [Q92766-1]
NP_001003699.1, NM_001003699.3 [Q92766-2]
NP_001003700.1, NM_001003700.1 [Q92766-3]
NP_001161816.1, NM_001168344.1 [Q92766-1]
XP_006715220.1, XM_006715157.3
XP_011513097.1, XM_011514795.2

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi112153, 21 interactors
CORUMiQ92766
IntActiQ92766, 21 interactors
STRINGi9606.ENSP00000369270

PTM databases

iPTMnetiQ92766
PhosphoSitePlusiQ92766
SwissPalmiQ92766

Polymorphism and mutation databases

BioMutaiRREB1
DMDMi152031673

Proteomic databases

EPDiQ92766
jPOSTiQ92766
MassIVEiQ92766
MaxQBiQ92766
PeptideAtlasiQ92766
PRIDEiQ92766
ProteomicsDBi75450 [Q92766-1]
75451 [Q92766-2]
75452 [Q92766-3]
75453 [Q92766-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6239

Genome annotation databases

EnsembliENST00000334984; ENSP00000335574; ENSG00000124782 [Q92766-3]
ENST00000349384; ENSP00000305560; ENSG00000124782 [Q92766-1]
ENST00000379933; ENSP00000369265; ENSG00000124782 [Q92766-1]
ENST00000379938; ENSP00000369270; ENSG00000124782 [Q92766-2]
GeneIDi6239
KEGGihsa:6239
UCSCiuc003mxb.4 human [Q92766-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6239
DisGeNETi6239

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RREB1
HGNCiHGNC:10449 RREB1
HPAiHPA001756
HPA034843
MalaCardsiRREB1
MIMi602209 gene
neXtProtiNX_Q92766
OpenTargetsiENSG00000124782
Orphaneti567 22q11.2 deletion syndrome
PharmGKBiPA34864

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000157533
InParanoidiQ92766
KOiK20210
OMAiIPKNFRR
OrthoDBi1318335at2759
PhylomeDBiQ92766
TreeFamiTF332503

Enzyme and pathway databases

SignaLinkiQ92766
SIGNORiQ92766

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RREB1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RREB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6239
PharosiQ92766

Protein Ontology

More...
PROi
PR:Q92766

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124782 Expressed in 230 organ(s), highest expression level in epithelium of mammary gland
ExpressionAtlasiQ92766 baseline and differential
GenevisibleiQ92766 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 4 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRREB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92766
Secondary accession number(s): A2RRF5
, E2GM80, E2GM81, O75567, O75568, Q5VYB2, Q6BEP5, Q6BEP6, Q6BEP8, Q86SU2, Q9Y474
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 10, 2007
Last modified: October 16, 2019
This is version 178 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again