Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-related protein 2/3 complex subunit 1A

Gene

ARPC1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-3928662 EPHB-mediated forward signaling
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
R-HSA-8856828 Clathrin-mediated endocytosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q92747

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92747

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-related protein 2/3 complex subunit 1A
Alternative name(s):
SOP2-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARPC1A
Synonyms:SOP2L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000241685.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:703 ARPC1A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604220 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92747

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10552

Open Targets

More...
OpenTargetsi
ENSG00000241685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24997

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARPC1A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
88984001

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000508521 – 370Actin-related protein 2/3 complex subunit 1AAdd BLAST370

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92747

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92747

PeptideAtlas

More...
PeptideAtlasi
Q92747

PRoteomics IDEntifications database

More...
PRIDEi
Q92747

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75438

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92747

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92747

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q92747

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000241685 Expressed in 222 organ(s), highest expression level in lower esophagus mucosa

CleanEx database of gene expression profiles

More...
CleanExi
HS_ARPC1A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92747 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92747 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA004334

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probable component of the Arp2/3 complex in which it may replace ARPC1B (Probable). In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115803, 35 interactors

Database of interacting proteins

More...
DIPi
DIP-33142N

Protein interaction database and analysis system

More...
IntActi
Q92747, 13 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262942

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q92747

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati6 – 45WD 1Add BLAST40
Repeati50 – 89WD 2Add BLAST40
Repeati140 – 179WD 3Add BLAST40
Repeati202 – 241WD 4Add BLAST40
Repeati244 – 284WD 5Add BLAST41
Repeati322 – 365WD 6Add BLAST44

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat ARPC1 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1523 Eukaryota
ENOG410XNWX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154210

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000181752

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050560

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92747

KEGG Orthology (KO)

More...
KOi
K05757

Identification of Orthologs from Complete Genome Data

More...
OMAi
SAMRKFQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G096H

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92747

TreeFam database of animal gene trees

More...
TreeFami
TF315041

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030140 ARC1A
IPR017383 ARPC1
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10709 PTHR10709, 1 hit
PTHR10709:SF11 PTHR10709:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 2 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038093 ARP2/3_su1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92747-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLHQFLLEP ITCHAWNRDR TQIALSPNNH EVHIYKKNGS QWVKAHELKE
60 70 80 90 100
HNGHITGIDW APKSDRIVTC GADRNAYVWS QKDGVWKPTL VILRINRAAT
110 120 130 140 150
FVKWSPLENK FAVGSGARLI SVCYFESEND WWVSKHIKKP IRSTVLSLDW
160 170 180 190 200
HPNNVLLAAG SCDFKCRVFS AYIKEVDEKP ASTPWGSKMP FGQLMSEFGG
210 220 230 240 250
SGTGGWVHGV SFSASGSRLA WVSHDSTVSV ADASKSVQVS TLKTEFLPLL
260 270 280 290 300
SVSFVSENSV VAAGHDCCPM LFNYDDRGCL TFVSKLDIPK QSIQRNMSAM
310 320 330 340 350
ERFRNMDKRA TTEDRNTALE TLHQNSITQV SIYEVDKQDC RKFCTTGIDG
360 370
AMTIWDFKTL ESSIQGLRIM
Length:370
Mass (Da):41,569
Last modified:February 21, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57FA5AC69997636E
GO
Isoform 2 (identifier: Q92747-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITG → MHERFIHCFC
     359-370: TLESSIQGLRIM → EPSRHGLPQLPGGAHQLPRLEQGPHPDCHLPQQP

Note: No experimental confirmation available.
Show »
Length:345
Mass (Da):38,603
Checksum:i84495A5242F16A89
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PF58E9PF58_HUMAN
Actin-related protein 2/3 complex s...
ARPC1A
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti127S → A in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti180P → K in CAA70203 (PubMed:8978670).Curated1
Sequence conflicti273N → I in CAA70203 (PubMed:8978670).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0563891 – 57MSLHQ…GHITG → MHERFIHCFC in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_056390359 – 370TLESS…GLRIM → EPSRHGLPQLPGGAHQLPRL EQGPHPDCHLPQQP in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y08999 mRNA Translation: CAA70203.1
AK297111 mRNA Translation: BAG59619.1
AC004834 Genomic DNA No translation available.
AC004922 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23883.1
CH471091 Genomic DNA Translation: EAW76682.1
CH471091 Genomic DNA Translation: EAW76683.1
BC039594 mRNA Translation: AAH39594.2
BC047889 mRNA Translation: AAH47889.2
BC054027 mRNA Translation: AAH54027.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5660.1 [Q92747-1]

NCBI Reference Sequences

More...
RefSeqi
NP_006400.2, NM_006409.3 [Q92747-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.124126

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262942; ENSP00000262942; ENSG00000241685 [Q92747-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10552

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10552

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08999 mRNA Translation: CAA70203.1
AK297111 mRNA Translation: BAG59619.1
AC004834 Genomic DNA No translation available.
AC004922 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23883.1
CH471091 Genomic DNA Translation: EAW76682.1
CH471091 Genomic DNA Translation: EAW76683.1
BC039594 mRNA Translation: AAH39594.2
BC047889 mRNA Translation: AAH47889.2
BC054027 mRNA Translation: AAH54027.1
CCDSiCCDS5660.1 [Q92747-1]
RefSeqiNP_006400.2, NM_006409.3 [Q92747-1]
UniGeneiHs.124126

3D structure databases

ProteinModelPortaliQ92747
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115803, 35 interactors
DIPiDIP-33142N
IntActiQ92747, 13 interactors
STRINGi9606.ENSP00000262942

PTM databases

iPTMnetiQ92747
PhosphoSitePlusiQ92747
SwissPalmiQ92747

Polymorphism and mutation databases

BioMutaiARPC1A
DMDMi88984001

Proteomic databases

EPDiQ92747
PaxDbiQ92747
PeptideAtlasiQ92747
PRIDEiQ92747
ProteomicsDBi75438

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10552
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262942; ENSP00000262942; ENSG00000241685 [Q92747-1]
GeneIDi10552
KEGGihsa:10552

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10552
DisGeNETi10552
EuPathDBiHostDB:ENSG00000241685.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARPC1A
HGNCiHGNC:703 ARPC1A
HPAiHPA004334
MIMi604220 gene
neXtProtiNX_Q92747
OpenTargetsiENSG00000241685
PharmGKBiPA24997

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1523 Eukaryota
ENOG410XNWX LUCA
GeneTreeiENSGT00940000154210
HOGENOMiHOG000181752
HOVERGENiHBG050560
InParanoidiQ92747
KOiK05757
OMAiSAMRKFQ
OrthoDBiEOG091G096H
PhylomeDBiQ92747
TreeFamiTF315041

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-3928662 EPHB-mediated forward signaling
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
R-HSA-8856828 Clathrin-mediated endocytosis
SignaLinkiQ92747
SIGNORiQ92747

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARPC1A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ARPC1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10552

Protein Ontology

More...
PROi
PR:Q92747

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000241685 Expressed in 222 organ(s), highest expression level in lower esophagus mucosa
CleanExiHS_ARPC1A
ExpressionAtlasiQ92747 baseline and differential
GenevisibleiQ92747 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR030140 ARC1A
IPR017383 ARPC1
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR10709 PTHR10709, 1 hit
PTHR10709:SF11 PTHR10709:SF11, 1 hit
PfamiView protein in Pfam
PF00400 WD40, 2 hits
PIRSFiPIRSF038093 ARP2/3_su1, 1 hit
SMARTiView protein in SMART
SM00320 WD40, 6 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARC1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92747
Secondary accession number(s): A4D276
, B4DLQ7, D6W5S1, Q7Z5U8, Q86WU5, Q8IXQ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: February 21, 2006
Last modified: December 5, 2018
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again