Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q92731 (ESR2_HUMAN)

Entry version 233 (07 Apr 2021)
Sequence version 2 (15 Jul 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Estrogen receptor beta

Gene

ESR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi149 – 214Nuclear receptorPROSITE-ProRule annotationAdd BLAST66
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandLipid-binding, Metal-binding, Steroid-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q92731

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1257604, PIP3 activates AKT signaling
R-HSA-2219530, Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8939211, ESR-mediated signaling
R-HSA-9009391, Extra-nuclear estrogen signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q92731

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q92731

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q92731, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Estrogen receptor beta
Short name:
ER-beta
Alternative name(s):
Nuclear receptor subfamily 3 group A member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ESR2
Synonyms:ESTRB, NR3A2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3468, ESR2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601663, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q92731

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000140009.18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ovarian dysgenesis 8 (ODG8)1 Publication
The disease may be caused by variants affecting the gene represented in this entry.
Disease descriptionA form of ovarian dysgenesis, a disorder characterized by lack of spontaneous pubertal development, primary amenorrhea, uterine hypoplasia, and hypergonadotropic hypogonadism as a result of streak gonads.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081788314K → R in ODG8; completely inactive in positive regulation of DNA-binding transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs1567753148EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi87S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-105. 1 Publication1
Mutagenesisi87S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-105. 1 Publication1
Mutagenesisi105S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-87. 1 Publication1
Mutagenesisi105S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-87. 1 Publication1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		2100

MalaCards human disease database

More...MalaCardsi		ESR2
MIMi618187, phenotype

Open Targets

More...OpenTargetsi		ENSG00000140009

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		99361, Familial medullary thyroid carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27886

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q92731, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL242

Drug and drug target database

More...DrugBanki		DB07638, (3AS,4R,9BR)-2,2-DIFLUORO-4-(4-HYDROXYPHENYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL
DB07036, (3aS,4R,9bR)-2,2-difluoro-4-(4-hydroxyphenyl)-6-(methoxymethyl)-1,2,3,3a,4,9b-hexahydrocyclopenta[c]chromen-8-ol
DB08020, (3AS,4R,9BR)-4-(4-HYDROXYPHENYL)-6-(METHOXYMETHYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL
DB07757, (9aS)-4-bromo-9a-butyl-7-hydroxy-1,2,9,9a-tetrahydro-3H-fluoren-3-one
DB07119, 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB07702, 17alpha-Estriol
DB07032, 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL
DB07009, 2-(5-HYDROXY-NAPHTHALEN-1-YL)-1,3-BENZOOXAZOL-6-OL
DB13869, 2-Methoxy-6-{(E)-[(4-methylphenyl)imino]methyl}phenol
DB07236, 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230, 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB04020, 4-(2-{[4-{[3-(4-Chlorophenyl)Propyl]Sulfanyl}-6-(1-Piperazinyl)-1,3,5-Triazin-2-Yl]Amino}Ethyl)Phenol
DB07150, 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB06937, 4-(6-HYDROXY-BENZO[D]ISOXAZOL-3-YL)BENZENE-1,3-DIOL
DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol
DB07198, 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927, [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB04468, Afimoxifene
DB06249, Arzoxifene
DB06401, Bazedoxifene
DB01878, Benzophenone
DB05882, CHF 4227
DB00286, Conjugated estrogens
DB00255, Diethylstilbestrol
DB11219, Enzacamene
DB11674, Equol
DB06875, ERB-196
DB07933, Erteberel
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB01196, Estramustine
DB04573, Estriol
DB14641, Estriol tripropionate
DB00655, Estrone
DB04574, Estrone sulfate
DB09086, Eugenol
DB15690, Fluoroestradiol F-18
DB01645, Genistein
DB03860, ICI-164384
DB06202, Lasofoxifene
DB05052, MF101
DB03467, Naringenin
DB09535, Octocrylene
DB01428, Oxybenzone
DB02983, Para-Mercury-Benzenesulfonic Acid
DB02746, Phthalic Acid
DB01708, Prasterone
DB06832, Prinaberel
DB00396, Progesterone
DB02757, Pyrazole
DB04216, Quercetin
DB00481, Raloxifene
DB00675, Tamoxifen
DB05966, TAS-108
DB01108, Trilostane

DrugCentral

More...DrugCentrali		Q92731

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		621

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ESR2

Domain mapping of disease mutations (DMDM)

More...DMDMi		6166154

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000536421 – 530Estrogen receptor betaAdd BLAST530

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei87Phosphoserine1 Publication1
Modified residuei105Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-87 and Ser-105 recruits NCOA1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q92731

PeptideAtlas

More...PeptideAtlasi		Q92731

PRoteomics IDEntifications database

More...PRIDEi		Q92731

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33568
75421 [Q92731-1]
75422 [Q92731-2]
75423 [Q92731-3]
75424 [Q92731-4]
75425 [Q92731-5]
75426 [Q92731-6]
75427 [Q92731-7]
75428 [Q92731-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q92731

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q92731

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q92731

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors. Isoform 2 is expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus. Isoform 4 is found in testis. Isoform 5 is expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus. Isoform 6 is expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000140009, Expressed in right adrenal gland and 137 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q92731, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q92731, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000140009, Tissue enhanced (ovary, testis, vagina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer. Can form a heterodimer with ESR1.

Interacts with NCOA1, NCOA3, NCOA5 and NCOA6 coactivators, leading to a strong increase of transcription of target genes.

Interacts with PELP1 and UBE1C. Isoform 2 preferentially forms a heterodimer with ESR1 rather than ESR2 and inhibits DNA-binding by ESR1.

Interacts with AKAP13.

Interacts with DNTTIP2.

Interacts with isoform 4 of TXNRD1.

Interacts with CCDC62 in the presence of estradiol/E2; this interaction seems to enhance the transcription of target genes, including cyclin-D1/CCND1 AP-1 promoter.

Interacts with DNAAF4 (By similarity).

Interacts with PRMT2.

Interacts with CCAR2 (via N-terminus) in a ligand-independent manner.

Interacts with RBM39, in the presence of estradiol (E2) (By similarity).

By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108404, 2279 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q92731

Database of interacting proteins

More...DIPi		DIP-5966N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q92731

Protein interaction database and analysis system

More...IntActi		Q92731, 462 interactors

Molecular INTeraction database

More...MINTi		Q92731

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000343925

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q92731

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q92731, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1530
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q92731

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q92731

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini264 – 498NR LBDPROSITE-ProRule annotationAdd BLAST235

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 148ModulatingAdd BLAST148

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR3 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3575, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156116

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_862048_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q92731

Identification of Orthologs from Complete Genome Data

More...OMAi		SHKEFSQ

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q92731

TreeFam database of animal gene trees

More...TreeFami		TF323751

Family and domain databases

Database of protein disorder

More...DisProti		DP00079

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00091

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028355, ER-beta/gamma
IPR021064, Estrogen_rcpt_beta_N
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR024178, Oest_rcpt/oest-rel_rcp
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12497, ERbeta_N, 1 hit
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF500102, ER-b, 1 hit
PIRSF002527, ER-like_NR, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92731-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDIKNSPSSL NSPSSYNCSQ SILPLEHGSI YIPSSYVDSH HEYPAMTFYS 
        60         70         80         90        100
PAVMNYSIPS NVTNLEGGPG RQTTSPNVLW PTPGHLSPLV VHRQLSHLYA 
       110        120        130        140        150
EPQKSPWCEA RSLEHTLPVN RETLKRKVSG NRCASPVTGP GSKRDAHFCA 
       160        170        180        190        200
VCSDYASGYH YGVWSCEGCK AFFKRSIQGH NDYICPATNQ CTIDKNRRKS 
       210        220        230        240        250
CQACRLRKCY EVGMVKCGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGG 
       260        270        280        290        300
HAPRVRELLL DALSPEQLVL TLLEAEPPHV LISRPSAPFT EASMMMSLTK 
       310        320        330        340        350
LADKELVHMI SWAKKIPGFV ELSLFDQVRL LESCWMEVLM MGLMWRSIDH 
       360        370        380        390        400
PGKLIFAPDL VLDRDEGKCV EGILEIFDML LATTSRFREL KLQHKEYLCV 
       410        420        430        440        450
KAMILLNSSM YPLVTATQDA DSSRKLAHLL NAVTDALVWV IAKSGISSQQ 
       460        470        480        490        500
QSMRLANLLM LLSHVRHASN KGMEHLLNMK CKNVVPVYDL LLEMLNAHVL 
       510        520        530
RGCKSSITGS ECSPAEDSKS KEGSQNPQSQ
Length:530
Mass (Da):59,216
Last modified:July 15, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8CAE34215992418A
GO
Isoform 2 (identifier: Q92731-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2, CX

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → RAEKASQTLTSFGMKMETLLPEATMEQ

Show »
Length:495
Mass (Da):55,483
Checksum:iF068DBC63DC838A6
GO
Isoform 3 (identifier: Q92731-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2A

The sequence of this isoform differs from the canonical sequence as follows:
     319-323: FVELS → MRGNA
     324-530: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:323
Mass (Da):35,944
Checksum:i158D376C56D3CA12
GO
Isoform 4 (identifier: Q92731-4) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → SSLSLSWRLF...SFEACQQPRE

Show »
Length:513
Mass (Da):57,518
Checksum:iEE88C42CBB24775E
GO
Isoform 5 (identifier: Q92731-5) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RWGEKQFIHLKLS

Note: Does not form homodimers.Curated
Show »
Length:481
Mass (Da):54,096
Checksum:i9B6017FE950720F0
GO
Isoform 6 (identifier: Q92731-6) [UniParc]FASTAAdd to basket
Also known as: Beta-5

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RYAP

Note: Does not form homodimers.Curated
Show »
Length:472
Mass (Da):52,959
Checksum:i673B0DB5FAF03C26
GO
Isoform 7 (identifier: Q92731-7) [UniParc]FASTAAdd to basket
Also known as: Beta-5A

The sequence of this isoform differs from the canonical sequence as follows:
     319-409: Missing.

Show »
Length:439
Mass (Da):48,614
Checksum:i35B686E3C0D32D0F
GO
Isoform 8 (identifier: Q92731-8) [UniParc]FASTAAdd to basket
Also known as: Beta-6

The sequence of this isoform differs from the canonical sequence as follows:
     365-375: DEGKCVEGILE → YVPSGHSDPGC
     376-530: Missing.

Show »
Length:375
Mass (Da):41,948
Checksum:iE2FA83EE3C519EE5
GO
Isoform 9 (identifier: Q92731-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-474: SNKGME → RSCVYK
     475-530: Missing.

Show »
Length:474
Mass (Da):53,209
Checksum:i4558F2986355FAF0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V5S2G3V5S2_HUMAN
Estrogen receptor beta
ESR2
513Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA67555 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08178684G → V Found in a patient with a 46,XY disorder of sex development; unknown pathological significance; no change in positive regulation of DNA-binding transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs1460814363Ensembl.1
Natural variantiVAR_081787181Missing Found in a patient with a 46,XY disorder of sex development; unknown pathological significance; shows increased positive regulation of DNA-binding transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs750091675Ensembl.1
Natural variantiVAR_081788314K → R in ODG8; completely inactive in positive regulation of DNA-binding transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs1567753148EnsemblClinVar.1
Natural variantiVAR_081789426L → R Found in a patient with a 46,XY disorder of sex development; unknown pathological significance; shows a higher positive regulation of DNA-binding transcription factor activity. 1 PublicationCorresponds to variant dbSNP:rs1217623435EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003685319 – 409Missing in isoform 7. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_003684319 – 323FVELS → MRGNA in isoform 3. 2 Publications5
Alternative sequenceiVSP_003686324 – 530Missing in isoform 3. 2 PublicationsAdd BLAST207
Alternative sequenceiVSP_003687365 – 375DEGKCVEGILE → YVPSGHSDPGC in isoform 8. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_003688376 – 530Missing in isoform 8. 1 PublicationAdd BLAST155
Alternative sequenceiVSP_003689469 – 530SNKGM…NPQSQ → RAEKASQTLTSFGMKMETLL PEATMEQ in isoform 2. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_003690469 – 530SNKGM…NPQSQ → SSLSLSWRLFMLREASCHGV RQTPGGAHMSVSRSRSFEAC QQPRE in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_003691469 – 530SNKGM…NPQSQ → RWGEKQFIHLKLS in isoform 5. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_003692469 – 530SNKGM…NPQSQ → RYAP in isoform 6. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_055746469 – 474SNKGME → RSCVYK in isoform 9. Curated6
Alternative sequenceiVSP_055747475 – 530Missing in isoform 9. CuratedAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB006590 mRNA Translation: BAA24953.1
AF051427 mRNA Translation: AAC05985.1
AF051428 mRNA Translation: AAC05751.1
AF061054 mRNA Translation: AAC39784.1
AF061055 mRNA Translation: AAC39785.1
AF060555 mRNA Translation: AAC15234.1
AF124790 mRNA Translation: AAD32580.1
AF047463 mRNA Translation: AAC03786.1
AB006589 mRNA Translation: BAA31966.1
DQ838582 mRNA Translation: ABH09189.1
DQ838583 mRNA Translation: ABH09190.1
AY785359 Genomic DNA Translation: AAV31779.1
AK292370 mRNA Translation: BAF85059.1
AL161756 Genomic DNA No translation available.
AL355094 Genomic DNA No translation available.
AL359235 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80850.1
BC024181 mRNA Translation: AAH24181.1
AF191544 Genomic DNA No translation available.
X99101 mRNA Translation: CAA67555.1 Different initiation.
AF074598 mRNA Translation: AAC25602.1
AF074599 mRNA Translation: AAC25603.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32096.1 [Q92731-2]
CCDS55920.1 [Q92731-5]
CCDS61469.1 [Q92731-7]
CCDS61470.1 [Q92731-9]
CCDS9762.1 [Q92731-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JC5939
PW0044
S71400

NCBI Reference Sequences

More...RefSeqi		NP_001035365.1, NM_001040275.1 [Q92731-2]
NP_001201831.1, NM_001214902.1 [Q92731-5]
NP_001258805.1, NM_001271876.1 [Q92731-9]
NP_001258806.1, NM_001271877.1 [Q92731-7]
NP_001278641.1, NM_001291712.1 [Q92731-2]
NP_001278652.1, NM_001291723.1 [Q92731-2]
NP_001428.1, NM_001437.2 [Q92731-1]
XP_016876568.1, XM_017021079.1 [Q92731-1]
XP_016876569.1, XM_017021080.1 [Q92731-1]
XP_016876570.1, XM_017021081.1 [Q92731-1]
XP_016876571.1, XM_017021082.1 [Q92731-1]
XP_016876572.1, XM_017021083.1 [Q92731-1]
XP_016876573.1, XM_017021084.1 [Q92731-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000267525; ENSP00000267525; ENSG00000140009 [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009 [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009 [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009 [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009 [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009 [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009 [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009 [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009 [Q92731-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2100

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2100

UCSC genome browser

More...UCSCi		uc001xgu.4, human [Q92731-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Wikipedia

Estrogen receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006590 mRNA Translation: BAA24953.1
AF051427 mRNA Translation: AAC05985.1
AF051428 mRNA Translation: AAC05751.1
AF061054 mRNA Translation: AAC39784.1
AF061055 mRNA Translation: AAC39785.1
AF060555 mRNA Translation: AAC15234.1
AF124790 mRNA Translation: AAD32580.1
AF047463 mRNA Translation: AAC03786.1
AB006589 mRNA Translation: BAA31966.1
DQ838582 mRNA Translation: ABH09189.1
DQ838583 mRNA Translation: ABH09190.1
AY785359 Genomic DNA Translation: AAV31779.1
AK292370 mRNA Translation: BAF85059.1
AL161756 Genomic DNA No translation available.
AL355094 Genomic DNA No translation available.
AL359235 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80850.1
BC024181 mRNA Translation: AAH24181.1
AF191544 Genomic DNA No translation available.
X99101 mRNA Translation: CAA67555.1 Different initiation.
AF074598 mRNA Translation: AAC25602.1
AF074599 mRNA Translation: AAC25603.1
CCDSiCCDS32096.1 [Q92731-2]
CCDS55920.1 [Q92731-5]
CCDS61469.1 [Q92731-7]
CCDS61470.1 [Q92731-9]
CCDS9762.1 [Q92731-1]
PIRiJC5939
PW0044
S71400
RefSeqiNP_001035365.1, NM_001040275.1 [Q92731-2]
NP_001201831.1, NM_001214902.1 [Q92731-5]
NP_001258805.1, NM_001271876.1 [Q92731-9]
NP_001258806.1, NM_001271877.1 [Q92731-7]
NP_001278641.1, NM_001291712.1 [Q92731-2]
NP_001278652.1, NM_001291723.1 [Q92731-2]
NP_001428.1, NM_001437.2 [Q92731-1]
XP_016876568.1, XM_017021079.1 [Q92731-1]
XP_016876569.1, XM_017021080.1 [Q92731-1]
XP_016876570.1, XM_017021081.1 [Q92731-1]
XP_016876571.1, XM_017021082.1 [Q92731-1]
XP_016876572.1, XM_017021083.1 [Q92731-1]
XP_016876573.1, XM_017021084.1 [Q92731-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
5TOAX-ray2.50A/B262-509[»]
SMRiQ92731
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108404, 2279 interactors
CORUMiQ92731
DIPiDIP-5966N
ELMiQ92731
IntActiQ92731, 462 interactors
MINTiQ92731
STRINGi9606.ENSP00000343925

Chemistry databases

BindingDBiQ92731
ChEMBLiCHEMBL242
DrugBankiDB07638, (3AS,4R,9BR)-2,2-DIFLUORO-4-(4-HYDROXYPHENYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL
DB07036, (3aS,4R,9bR)-2,2-difluoro-4-(4-hydroxyphenyl)-6-(methoxymethyl)-1,2,3,3a,4,9b-hexahydrocyclopenta[c]chromen-8-ol
DB08020, (3AS,4R,9BR)-4-(4-HYDROXYPHENYL)-6-(METHOXYMETHYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL
DB07757, (9aS)-4-bromo-9a-butyl-7-hydroxy-1,2,9,9a-tetrahydro-3H-fluoren-3-one
DB07119, 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB07702, 17alpha-Estriol
DB07032, 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL
DB07009, 2-(5-HYDROXY-NAPHTHALEN-1-YL)-1,3-BENZOOXAZOL-6-OL
DB13869, 2-Methoxy-6-{(E)-[(4-methylphenyl)imino]methyl}phenol
DB07236, 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230, 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB04020, 4-(2-{[4-{[3-(4-Chlorophenyl)Propyl]Sulfanyl}-6-(1-Piperazinyl)-1,3,5-Triazin-2-Yl]Amino}Ethyl)Phenol
DB07150, 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB06937, 4-(6-HYDROXY-BENZO[D]ISOXAZOL-3-YL)BENZENE-1,3-DIOL
DB03882, 5-Alpha-Androstane-3-Beta,17beta-Diol
DB07198, 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927, [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB04468, Afimoxifene
DB06249, Arzoxifene
DB06401, Bazedoxifene
DB01878, Benzophenone
DB05882, CHF 4227
DB00286, Conjugated estrogens
DB00255, Diethylstilbestrol
DB11219, Enzacamene
DB11674, Equol
DB06875, ERB-196
DB07933, Erteberel
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB01196, Estramustine
DB04573, Estriol
DB14641, Estriol tripropionate
DB00655, Estrone
DB04574, Estrone sulfate
DB09086, Eugenol
DB15690, Fluoroestradiol F-18
DB01645, Genistein
DB03860, ICI-164384
DB06202, Lasofoxifene
DB05052, MF101
DB03467, Naringenin
DB09535, Octocrylene
DB01428, Oxybenzone
DB02983, Para-Mercury-Benzenesulfonic Acid
DB02746, Phthalic Acid
DB01708, Prasterone
DB06832, Prinaberel
DB00396, Progesterone
DB02757, Pyrazole
DB04216, Quercetin
DB00481, Raloxifene
DB00675, Tamoxifen
DB05966, TAS-108
DB01108, Trilostane
DrugCentraliQ92731
GuidetoPHARMACOLOGYi621

Protein family/group databases

MoonDBiQ92731, Predicted

PTM databases

iPTMnetiQ92731
PhosphoSitePlusiQ92731
SwissPalmiQ92731

Genetic variation databases

BioMutaiESR2
DMDMi6166154

Proteomic databases

PaxDbiQ92731
PeptideAtlasiQ92731
PRIDEiQ92731
ProteomicsDBi33568
75421 [Q92731-1]
75422 [Q92731-2]
75423 [Q92731-3]
75424 [Q92731-4]
75425 [Q92731-5]
75426 [Q92731-6]
75427 [Q92731-7]
75428 [Q92731-8]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11874, 1715 antibodies

Genome annotation databases

EnsembliENST00000267525; ENSP00000267525; ENSG00000140009 [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009 [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009 [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009 [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009 [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009 [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009 [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009 [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009 [Q92731-6]
GeneIDi2100
KEGGihsa:2100
UCSCiuc001xgu.4, human [Q92731-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2100
DisGeNETi2100

GeneCards: human genes, protein and diseases

More...GeneCardsi		ESR2
HGNCiHGNC:3468, ESR2
HPAiENSG00000140009, Tissue enhanced (ovary, testis, vagina)
MalaCardsiESR2
MIMi601663, gene
618187, phenotype
neXtProtiNX_Q92731
OpenTargetsiENSG00000140009
Orphaneti99361, Familial medullary thyroid carcinoma
PharmGKBiPA27886
VEuPathDBiHostDB:ENSG00000140009.18

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3575, Eukaryota
GeneTreeiENSGT00940000156116
HOGENOMiCLU_862048_0_0_1
InParanoidiQ92731
OMAiSHKEFSQ
PhylomeDBiQ92731
TreeFamiTF323751

Enzyme and pathway databases

PathwayCommonsiQ92731
ReactomeiR-HSA-1257604, PIP3 activates AKT signaling
R-HSA-2219530, Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8939211, ESR-mediated signaling
R-HSA-9009391, Extra-nuclear estrogen signaling
SignaLinkiQ92731
SIGNORiQ92731

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2100, 8 hits in 1008 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ESR2, human
EvolutionaryTraceiQ92731

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Estrogen_receptor_beta

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2100
PharosiQ92731, Tclin

Protein Ontology

More...PROi		PR:Q92731
RNActiQ92731, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000140009, Expressed in right adrenal gland and 137 other tissues
ExpressionAtlasiQ92731, baseline and differential
GenevisibleiQ92731, HS

Family and domain databases

DisProtiDP00079
Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
IDEALiIID00091
InterProiView protein in InterPro
IPR028355, ER-beta/gamma
IPR021064, Estrogen_rcpt_beta_N
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR024178, Oest_rcpt/oest-rel_rcp
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF12497, ERbeta_N, 1 hit
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PIRSFiPIRSF500102, ER-b, 1 hit
PIRSF002527, ER-like_NR, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiESR2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92731
Secondary accession number(s): A8K8K5
, G3V5M5, O60608, O60685, O60702, O60703, O75583, O75584, Q0MWT5, Q0MWT6, Q86Z31, Q9UEV6, Q9UHD3, Q9UQK9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 15, 1999
Last modified: April 7, 2021
This is version 233 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again