Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 219 (13 Feb 2019)
Sequence version 2 (15 Jul 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Estrogen receptor beta

Gene

ESR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi149 – 214Nuclear receptorPROSITE-ProRule annotationAdd BLAST66
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandLipid-binding, Metal-binding, Steroid-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1257604 PIP3 activates AKT signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8939211 ESR-mediated signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q92731

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92731

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q92731 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Estrogen receptor beta
Short name:
ER-beta
Alternative name(s):
Nuclear receptor subfamily 3 group A member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ESR2
Synonyms:ESTRB, NR3A2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000140009.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3468 ESR2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601663 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92731

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi87S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-105. 1 Publication1
Mutagenesisi87S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-105. 1 Publication1
Mutagenesisi105S → A: Enhances repression by activated ErbB2/ErbB3; when associated with A-87. 1 Publication1
Mutagenesisi105S → D: Abolishes repression by activated ErbB2/ErbB3; when associated with D-87. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
2100

MalaCards human disease database

More...
MalaCardsi
ESR2

Open Targets

More...
OpenTargetsi
ENSG00000140009

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
99361 Familial medullary thyroid carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27886

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL242

Drug and drug target database

More...
DrugBanki
DB07119 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB07032 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL
DB06875 3-(3-FLUORO-4-HYDROXYPHENYL)-7-HYDROXY-1-NAPHTHONITRILE
DB07236 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB07150 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB07198 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927 [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB04468 Afimoxifene
DB05882 CHF 4227
DB00255 Diethylstilbestrol
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB04574 Estrone sulfate
DB01645 Genistein
DB06202 Lasofoxifene
DB05052 MF101
DB02983 Para-Mercury-Benzenesulfonic Acid
DB01708 Prasterone
DB00481 Raloxifene
DB00675 Tamoxifen
DB01108 Trilostane

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
621

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ESR2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6166154

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000536421 – 530Estrogen receptor betaAdd BLAST530

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei87Phosphoserine1 Publication1
Modified residuei105Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-87 and Ser-105 recruits NCOA1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92731

PeptideAtlas

More...
PeptideAtlasi
Q92731

PRoteomics IDEntifications database

More...
PRIDEi
Q92731

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75421
75422 [Q92731-2]
75423 [Q92731-3]
75424 [Q92731-4]
75425 [Q92731-5]
75426 [Q92731-6]
75427 [Q92731-7]
75428 [Q92731-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92731

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92731

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q92731

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q92731

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors. Isoform 2 is expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus. Isoform 4 is found in testis. Isoform 5 is expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus. Isoform 6 is expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140009 Expressed in 117 organ(s), highest expression level in right adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92731 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92731 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB065126

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer. Can form a heterodimer with ESR1. Interacts with NCOA1, NCOA3, NCOA5 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Interacts with PELP1 and UBE1C. Isoform 2 preferentially forms a heterodimer with ESR1 rather than ESR2 and inhibits DNA-binding by ESR1. Interacts with AKAP13. Interacts with DNTTIP2. Interacts with isoform 4 of TXNRD1. Interacts with CCDC62 in the presence of estradiol/E2; this interaction seems to enhance the transcription of target genes, including cyclin-D1/CCND1 AP-1 promoter. Interacts with DNAAF4 (By similarity). Interacts with PRMT2. Interacts with CCAR2 (via N-terminus) in a ligand-independent manner. Interacts with RBM39, in the presence of estradiol (E2) (By similarity).By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108404, 102 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q92731

Database of interacting proteins

More...
DIPi
DIP-5966N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q92731

Protein interaction database and analysis system

More...
IntActi
Q92731, 456 interactors

Molecular INTeraction database

More...
MINTi
Q92731

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000343925

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q92731

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1530
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
5TOAX-ray2.50A/B262-509[»]

Database of protein disorder

More...
DisProti
DP00079

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q92731

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92731

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q92731

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini264 – 498NR LBDPROSITE-ProRule annotationAdd BLAST235

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 148ModulatingAdd BLAST148

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri149 – 169NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri185 – 209NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3575 Eukaryota
ENOG410XRZC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156116

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108344

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92731

KEGG Orthology (KO)

More...
KOi
K08551

Identification of Orthologs from Complete Genome Data

More...
OMAi
VESHHEY

Database of Orthologous Groups

More...
OrthoDBi
487299at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92731

TreeFam database of animal gene trees

More...
TreeFami
TF323751

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028355 ER-beta/gamma
IPR021064 Estrogen_rcpt_beta_N
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR024178 Oest_rcpt/oest-rel_rcp
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12497 ERbeta_N, 1 hit
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF500102 ER-b, 1 hit
PIRSF002527 ER-like_NR, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00398 STRDHORMONER
PR00047 STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92731-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDIKNSPSSL NSPSSYNCSQ SILPLEHGSI YIPSSYVDSH HEYPAMTFYS
60 70 80 90 100
PAVMNYSIPS NVTNLEGGPG RQTTSPNVLW PTPGHLSPLV VHRQLSHLYA
110 120 130 140 150
EPQKSPWCEA RSLEHTLPVN RETLKRKVSG NRCASPVTGP GSKRDAHFCA
160 170 180 190 200
VCSDYASGYH YGVWSCEGCK AFFKRSIQGH NDYICPATNQ CTIDKNRRKS
210 220 230 240 250
CQACRLRKCY EVGMVKCGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGG
260 270 280 290 300
HAPRVRELLL DALSPEQLVL TLLEAEPPHV LISRPSAPFT EASMMMSLTK
310 320 330 340 350
LADKELVHMI SWAKKIPGFV ELSLFDQVRL LESCWMEVLM MGLMWRSIDH
360 370 380 390 400
PGKLIFAPDL VLDRDEGKCV EGILEIFDML LATTSRFREL KLQHKEYLCV
410 420 430 440 450
KAMILLNSSM YPLVTATQDA DSSRKLAHLL NAVTDALVWV IAKSGISSQQ
460 470 480 490 500
QSMRLANLLM LLSHVRHASN KGMEHLLNMK CKNVVPVYDL LLEMLNAHVL
510 520 530
RGCKSSITGS ECSPAEDSKS KEGSQNPQSQ
Length:530
Mass (Da):59,216
Last modified:July 15, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8CAE34215992418A
GO
Isoform 2 (identifier: Q92731-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2, CX

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → RAEKASQTLTSFGMKMETLLPEATMEQ

Show »
Length:495
Mass (Da):55,483
Checksum:iF068DBC63DC838A6
GO
Isoform 3 (identifier: Q92731-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2A

The sequence of this isoform differs from the canonical sequence as follows:
     319-323: FVELS → MRGNA
     324-530: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:323
Mass (Da):35,944
Checksum:i158D376C56D3CA12
GO
Isoform 4 (identifier: Q92731-4) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLN...KEGSQNPQSQ → SSLSLSWRLF...SFEACQQPRE

Show »
Length:513
Mass (Da):57,518
Checksum:iEE88C42CBB24775E
GO
Isoform 5 (identifier: Q92731-5) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RWGEKQFIHLKLS

Note: Does not form homodimers.
Show »
Length:481
Mass (Da):54,096
Checksum:i9B6017FE950720F0
GO
Isoform 6 (identifier: Q92731-6) [UniParc]FASTAAdd to basket
Also known as: Beta-5

The sequence of this isoform differs from the canonical sequence as follows:
     469-530: SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ → RYAP

Note: Does not form homodimers.
Show »
Length:472
Mass (Da):52,959
Checksum:i673B0DB5FAF03C26
GO
Isoform 7 (identifier: Q92731-7) [UniParc]FASTAAdd to basket
Also known as: Beta-5A

The sequence of this isoform differs from the canonical sequence as follows:
     319-409: Missing.

Show »
Length:439
Mass (Da):48,614
Checksum:i35B686E3C0D32D0F
GO
Isoform 8 (identifier: Q92731-8) [UniParc]FASTAAdd to basket
Also known as: Beta-6

The sequence of this isoform differs from the canonical sequence as follows:
     365-375: DEGKCVEGILE → YVPSGHSDPGC
     376-530: Missing.

Show »
Length:375
Mass (Da):41,948
Checksum:iE2FA83EE3C519EE5
GO
Isoform 9 (identifier: Q92731-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     469-474: SNKGME → RSCVYK
     475-530: Missing.

Show »
Length:474
Mass (Da):53,209
Checksum:i4558F2986355FAF0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V5S2G3V5S2_HUMAN
Estrogen receptor beta
ESR2
513Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA67555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003685319 – 409Missing in isoform 7. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_003684319 – 323FVELS → MRGNA in isoform 3. 2 Publications5
Alternative sequenceiVSP_003686324 – 530Missing in isoform 3. 2 PublicationsAdd BLAST207
Alternative sequenceiVSP_003687365 – 375DEGKCVEGILE → YVPSGHSDPGC in isoform 8. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_003688376 – 530Missing in isoform 8. 1 PublicationAdd BLAST155
Alternative sequenceiVSP_003689469 – 530SNKGM…NPQSQ → RAEKASQTLTSFGMKMETLL PEATMEQ in isoform 2. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_003690469 – 530SNKGM…NPQSQ → SSLSLSWRLFMLREASCHGV RQTPGGAHMSVSRSRSFEAC QQPRE in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_003691469 – 530SNKGM…NPQSQ → RWGEKQFIHLKLS in isoform 5. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_003692469 – 530SNKGM…NPQSQ → RYAP in isoform 6. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_055746469 – 474SNKGME → RSCVYK in isoform 9. Curated6
Alternative sequenceiVSP_055747475 – 530Missing in isoform 9. CuratedAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB006590 mRNA Translation: BAA24953.1
AF051427 mRNA Translation: AAC05985.1
AF051428 mRNA Translation: AAC05751.1
AF061054 mRNA Translation: AAC39784.1
AF061055 mRNA Translation: AAC39785.1
AF060555 mRNA Translation: AAC15234.1
AF124790 mRNA Translation: AAD32580.1
AF047463 mRNA Translation: AAC03786.1
AB006589 mRNA Translation: BAA31966.1
DQ838582 mRNA Translation: ABH09189.1
DQ838583 mRNA Translation: ABH09190.1
AY785359 Genomic DNA Translation: AAV31779.1
AK292370 mRNA Translation: BAF85059.1
AL161756 Genomic DNA No translation available.
AL355094 Genomic DNA No translation available.
AL359235 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80850.1
BC024181 mRNA Translation: AAH24181.1
AF191544 Genomic DNA No translation available.
X99101 mRNA Translation: CAA67555.1 Different initiation.
AF074598 mRNA Translation: AAC25602.1
AF074599 mRNA Translation: AAC25603.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32096.1 [Q92731-2]
CCDS55920.1 [Q92731-5]
CCDS61469.1 [Q92731-7]
CCDS61470.1 [Q92731-9]
CCDS9762.1 [Q92731-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC5939
PW0044
S71400

NCBI Reference Sequences

More...
RefSeqi
NP_001035365.1, NM_001040275.1 [Q92731-2]
NP_001201831.1, NM_001214902.1 [Q92731-5]
NP_001258805.1, NM_001271876.1 [Q92731-9]
NP_001258806.1, NM_001271877.1 [Q92731-7]
NP_001278641.1, NM_001291712.1 [Q92731-2]
NP_001278652.1, NM_001291723.1 [Q92731-2]
NP_001428.1, NM_001437.2 [Q92731-1]
XP_016876568.1, XM_017021079.1 [Q92731-1]
XP_016876569.1, XM_017021080.1 [Q92731-1]
XP_016876570.1, XM_017021081.1 [Q92731-1]
XP_016876571.1, XM_017021082.1 [Q92731-1]
XP_016876572.1, XM_017021083.1 [Q92731-1]
XP_016876573.1, XM_017021084.1 [Q92731-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.660607
Hs.734038
Hs.734416

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000267525; ENSP00000267525; ENSG00000140009 [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009 [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009 [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009 [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009 [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009 [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009 [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009 [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009 [Q92731-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2100

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2100

UCSC genome browser

More...
UCSCi
uc001xgu.4 human [Q92731-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Wikipedia

Estrogen receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006590 mRNA Translation: BAA24953.1
AF051427 mRNA Translation: AAC05985.1
AF051428 mRNA Translation: AAC05751.1
AF061054 mRNA Translation: AAC39784.1
AF061055 mRNA Translation: AAC39785.1
AF060555 mRNA Translation: AAC15234.1
AF124790 mRNA Translation: AAD32580.1
AF047463 mRNA Translation: AAC03786.1
AB006589 mRNA Translation: BAA31966.1
DQ838582 mRNA Translation: ABH09189.1
DQ838583 mRNA Translation: ABH09190.1
AY785359 Genomic DNA Translation: AAV31779.1
AK292370 mRNA Translation: BAF85059.1
AL161756 Genomic DNA No translation available.
AL355094 Genomic DNA No translation available.
AL359235 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80850.1
BC024181 mRNA Translation: AAH24181.1
AF191544 Genomic DNA No translation available.
X99101 mRNA Translation: CAA67555.1 Different initiation.
AF074598 mRNA Translation: AAC25602.1
AF074599 mRNA Translation: AAC25603.1
CCDSiCCDS32096.1 [Q92731-2]
CCDS55920.1 [Q92731-5]
CCDS61469.1 [Q92731-7]
CCDS61470.1 [Q92731-9]
CCDS9762.1 [Q92731-1]
PIRiJC5939
PW0044
S71400
RefSeqiNP_001035365.1, NM_001040275.1 [Q92731-2]
NP_001201831.1, NM_001214902.1 [Q92731-5]
NP_001258805.1, NM_001271876.1 [Q92731-9]
NP_001258806.1, NM_001271877.1 [Q92731-7]
NP_001278641.1, NM_001291712.1 [Q92731-2]
NP_001278652.1, NM_001291723.1 [Q92731-2]
NP_001428.1, NM_001437.2 [Q92731-1]
XP_016876568.1, XM_017021079.1 [Q92731-1]
XP_016876569.1, XM_017021080.1 [Q92731-1]
XP_016876570.1, XM_017021081.1 [Q92731-1]
XP_016876571.1, XM_017021082.1 [Q92731-1]
XP_016876572.1, XM_017021083.1 [Q92731-1]
XP_016876573.1, XM_017021084.1 [Q92731-2]
UniGeneiHs.660607
Hs.734038
Hs.734416

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L2JX-ray2.95A/B256-505[»]
1NDEX-ray3.00A256-501[»]
1QKMX-ray1.80A255-509[»]
1U3QX-ray2.40A/B/C/D261-500[»]
1U3RX-ray2.21A/B261-501[»]
1U3SX-ray2.50A/B261-500[»]
1U9EX-ray2.40A/B261-501[»]
1X76X-ray2.20A/B261-500[»]
1X78X-ray2.30A/B261-500[»]
1X7BX-ray2.30A/B261-500[»]
1X7JX-ray2.30A/B261-500[»]
1YY4X-ray2.70A/B263-530[»]
1YYEX-ray2.03A/B263-530[»]
1ZAFX-ray2.20A/B263-500[»]
2FSZX-ray2.20A/B257-502[»]
2GIUX-ray2.20A260-500[»]
2I0GX-ray2.50A/B256-505[»]
2JJ3X-ray2.28A/B256-505[»]
2NV7X-ray2.10A/B263-500[»]
2QTUX-ray2.53A/B256-505[»]
2YJDX-ray1.93A/B261-500[»]
2YLYX-ray3.20A/B260-500[»]
2Z4BX-ray2.34A/B256-505[»]
3OLLX-ray1.50A/B261-500[»]
3OLSX-ray2.20A/B261-500[»]
3OMOX-ray2.21A/B261-500[»]
3OMPX-ray2.05A/B261-500[»]
3OMQX-ray1.97A/B261-500[»]
4J24X-ray2.10A/B/C/D261-500[»]
4J26X-ray2.30A/B261-500[»]
4ZI1X-ray2.10A262-509[»]
5TOAX-ray2.50A/B262-509[»]
DisProtiDP00079
ProteinModelPortaliQ92731
SMRiQ92731
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108404, 102 interactors
CORUMiQ92731
DIPiDIP-5966N
ELMiQ92731
IntActiQ92731, 456 interactors
MINTiQ92731
STRINGi9606.ENSP00000343925

Chemistry databases

BindingDBiQ92731
ChEMBLiCHEMBL242
DrugBankiDB07119 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB07032 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL
DB06875 3-(3-FLUORO-4-HYDROXYPHENYL)-7-HYDROXY-1-NAPHTHONITRILE
DB07236 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB07150 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB07198 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927 [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB04468 Afimoxifene
DB05882 CHF 4227
DB00255 Diethylstilbestrol
DB00783 Estradiol
DB01196 Estramustine
DB04573 Estriol
DB04574 Estrone sulfate
DB01645 Genistein
DB06202 Lasofoxifene
DB05052 MF101
DB02983 Para-Mercury-Benzenesulfonic Acid
DB01708 Prasterone
DB00481 Raloxifene
DB00675 Tamoxifen
DB01108 Trilostane
GuidetoPHARMACOLOGYi621

Protein family/group databases

MoonDBiQ92731 Predicted

PTM databases

iPTMnetiQ92731
PhosphoSitePlusiQ92731
SwissPalmiQ92731

Polymorphism and mutation databases

BioMutaiESR2
DMDMi6166154

Proteomic databases

PaxDbiQ92731
PeptideAtlasiQ92731
PRIDEiQ92731
ProteomicsDBi75421
75422 [Q92731-2]
75423 [Q92731-3]
75424 [Q92731-4]
75425 [Q92731-5]
75426 [Q92731-6]
75427 [Q92731-7]
75428 [Q92731-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267525; ENSP00000267525; ENSG00000140009 [Q92731-7]
ENST00000341099; ENSP00000343925; ENSG00000140009 [Q92731-1]
ENST00000344288; ENSP00000345616; ENSG00000140009 [Q92731-3]
ENST00000353772; ENSP00000335551; ENSG00000140009 [Q92731-2]
ENST00000358599; ENSP00000351412; ENSG00000140009 [Q92731-2]
ENST00000553796; ENSP00000452426; ENSG00000140009 [Q92731-9]
ENST00000554572; ENSP00000450699; ENSG00000140009 [Q92731-2]
ENST00000555278; ENSP00000450488; ENSG00000140009 [Q92731-5]
ENST00000557772; ENSP00000451582; ENSG00000140009 [Q92731-6]
GeneIDi2100
KEGGihsa:2100
UCSCiuc001xgu.4 human [Q92731-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2100
DisGeNETi2100
EuPathDBiHostDB:ENSG00000140009.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ESR2
HGNCiHGNC:3468 ESR2
HPAiCAB065126
MalaCardsiESR2
MIMi601663 gene
neXtProtiNX_Q92731
OpenTargetsiENSG00000140009
Orphaneti99361 Familial medullary thyroid carcinoma
PharmGKBiPA27886

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00940000156116
HOVERGENiHBG108344
InParanoidiQ92731
KOiK08551
OMAiVESHHEY
OrthoDBi487299at2759
PhylomeDBiQ92731
TreeFamiTF323751

Enzyme and pathway databases

ReactomeiR-HSA-1257604 PIP3 activates AKT signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-8939211 ESR-mediated signaling
SignaLinkiQ92731
SIGNORiQ92731

Miscellaneous databases

EvolutionaryTraceiQ92731

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Estrogen_receptor_beta

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2100
PMAP-CutDBiQ92731

Protein Ontology

More...
PROi
PR:Q92731

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140009 Expressed in 117 organ(s), highest expression level in right adrenal gland
ExpressionAtlasiQ92731 baseline and differential
GenevisibleiQ92731 HS

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR028355 ER-beta/gamma
IPR021064 Estrogen_rcpt_beta_N
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR024178 Oest_rcpt/oest-rel_rcp
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF12497 ERbeta_N, 1 hit
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PIRSFiPIRSF500102 ER-b, 1 hit
PIRSF002527 ER-like_NR, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiESR2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92731
Secondary accession number(s): A8K8K5
, G3V5M5, O60608, O60685, O60702, O60703, O75583, O75584, Q0MWT5, Q0MWT6, Q86Z31, Q9UEV6, Q9UHD3, Q9UQK9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 15, 1999
Last modified: February 13, 2019
This is version 219 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again