Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity immunoglobulin gamma Fc receptor IB

Gene

FCGR1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.2 Publications

GO - Molecular functioni

  • IgG binding Source: UniProtKB-KW
  • immunoglobulin receptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionIgG-binding protein, Receptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiR-HSA-1236978 Cross-presentation of soluble exogenous antigens (endosomes)
R-HSA-877300 Interferon gamma signaling

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin gamma Fc receptor IB
Short name:
IgG Fc receptor IB
Alternative name(s):
Fc-gamma RIB
Short name:
FcRIB
Short name:
hFcgammaRIB
Gene namesi
Name:FCGR1B
Synonyms:IGFRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000198019.12
HGNCiHGNC:3614 FCGR1B
MIMi601502 gene
neXtProtiNX_Q92637

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini16 – 198ExtracellularSequence analysisAdd BLAST183
Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 280CytoplasmicSequence analysisAdd BLAST61

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2210
OpenTargetsiENSG00000198019
PharmGKBiPA28061

Chemistry databases

DrugBankiDB00028 Immune Globulin Human

Polymorphism and mutation databases

BioMutaiFCGR1B
DMDMi74760649

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000033146216 – 280High affinity immunoglobulin gamma Fc receptor IBAdd BLAST265

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi43 ↔ 85PROSITE-ProRule annotation
Glycosylationi59N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi124 ↔ 168PROSITE-ProRule annotation
Glycosylationi152N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ92637
PeptideAtlasiQ92637
PRIDEiQ92637
ProteomicsDBi75392
75393 [Q92637-2]
75394 [Q92637-3]

PTM databases

iPTMnetiQ92637
PhosphoSitePlusiQ92637

Expressioni

Inductioni

Up-regulated by IFNG/IFN-gamma.2 Publications

Gene expression databases

BgeeiENSG00000198019 Expressed in 90 organ(s), highest expression level in blood
CleanExiHS_FCGR1B
ExpressionAtlasiQ92637 baseline and differential
GenevisibleiQ92637 HS

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000358391

Structurei

3D structure databases

ProteinModelPortaliQ92637
SMRiQ92637
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 101Ig-like C2-type 1Add BLAST80
Domaini95 – 184Ig-like C2-type 2Add BLAST90

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVK2 Eukaryota
ENOG410YF57 LUCA
GeneTreeiENSGT00760000119130
HOGENOMiHOG000251632
HOVERGENiHBG051602
InParanoidiQ92637
PhylomeDBiQ92637
TreeFamiTF335097

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 1 hit
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92637-1) [UniParc]FASTAAdd to basket
Also known as: b2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWFLTTLLLW VPVDGQVDTT KAVITLQPPW VSVFQEETVT LHCEVLHLPG
60 70 80 90 100
SSSTQWFLNG TATQTSTPSY RITSASVNDS GEYRCQRGLS GRSDPIQLEI
110 120 130 140 150
HRGWLLLQVS SRVFMEGEPL ALRCHAWKDK LVYNVLYYRN GKAFKFFHWN
160 170 180 190 200
SNLTILKTNI SHNGTYHCSG MGKHRYTSAG ISQYTVKGLQ LPTPVWFHVL
210 220 230 240 250
FYLAVGIMFL VNTVLWVTIR KELKRKKKWN LEISLDSGHE KKVISSLQED
260 270 280
RHLEEELKCQ EQKEEQLQEG VHRKEPQGAT
Length:280
Mass (Da):32,232
Last modified:February 1, 1997 - v1
Checksum:iC6C6C45AE3D345C6
GO
Isoform 2 (identifier: Q92637-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     188-223: GLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL → ELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGL
     224-280: Missing.

Show »
Length:224
Mass (Da):25,203
Checksum:iA7C9280734DB02A9
GO
Isoform 3 (identifier: Q92637-3) [UniParc]FASTAAdd to basket
Also known as: b3

The sequence of this isoform differs from the canonical sequence as follows:
     11-102: Missing.

Show »
Length:188
Mass (Da):22,136
Checksum:iF46517B3279ABEF9
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRM3A0A0A0MRM3_HUMAN
High affinity immunoglobulin gamma ...
FCGR1B
280Annotation score:
A0A087WXZ6A0A087WXZ6_HUMAN
High affinity immunoglobulin gamma ...
FCGR1B
249Annotation score:
A0A087WUG7A0A087WUG7_HUMAN
High affinity immunoglobulin gamma ...
FCGR1B
225Annotation score:
A0A087WVS4A0A087WVS4_HUMAN
High affinity immunoglobulin gamma ...
FCGR1B
224Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti154T → A in AAA35826 (PubMed:1430234).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03321511 – 102Missing in isoform 3. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033216188 – 223GLQLP…IRKEL → ELFPAPVLNASVTSPLLEGN LVTLSCETKLLLQRPGL in isoform 2. CuratedAdd BLAST36
Alternative sequenceiVSP_033217224 – 280Missing in isoform 2. CuratedAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA Translation: AAA35825.1
L03420 mRNA Translation: AAA35826.1
S45709
, S45704, S45705, S45707, S45708 Genomic DNA Translation: AAD13842.1
AL357493 Genomic DNA No translation available.
CCDSiCCDS72844.1 [Q92637-2]
CCDS72845.1 [Q92637-1]
CCDS72846.1 [Q92637-3]
PIRiI55577
RefSeqiNP_001004340.2, NM_001004340.3 [Q92637-3]
NP_001017986.1, NM_001017986.3 [Q92637-1]
NP_001231839.1, NM_001244910.1 [Q92637-2]
UniGeneiHs.534956

Genome annotation databases

EnsembliENST00000369383; ENSP00000358390; ENSG00000198019 [Q92637-3]
GeneIDi2210
KEGGihsa:2210
UCSCiuc031upv.2 human [Q92637-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L03419 mRNA Translation: AAA35825.1
L03420 mRNA Translation: AAA35826.1
S45709
, S45704, S45705, S45707, S45708 Genomic DNA Translation: AAD13842.1
AL357493 Genomic DNA No translation available.
CCDSiCCDS72844.1 [Q92637-2]
CCDS72845.1 [Q92637-1]
CCDS72846.1 [Q92637-3]
PIRiI55577
RefSeqiNP_001004340.2, NM_001004340.3 [Q92637-3]
NP_001017986.1, NM_001017986.3 [Q92637-1]
NP_001231839.1, NM_001244910.1 [Q92637-2]
UniGeneiHs.534956

3D structure databases

ProteinModelPortaliQ92637
SMRiQ92637
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000358391

Chemistry databases

DrugBankiDB00028 Immune Globulin Human

PTM databases

iPTMnetiQ92637
PhosphoSitePlusiQ92637

Polymorphism and mutation databases

BioMutaiFCGR1B
DMDMi74760649

Proteomic databases

PaxDbiQ92637
PeptideAtlasiQ92637
PRIDEiQ92637
ProteomicsDBi75392
75393 [Q92637-2]
75394 [Q92637-3]

Protocols and materials databases

DNASUi2210
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369383; ENSP00000358390; ENSG00000198019 [Q92637-3]
GeneIDi2210
KEGGihsa:2210
UCSCiuc031upv.2 human [Q92637-1]

Organism-specific databases

CTDi2210
DisGeNETi2210
EuPathDBiHostDB:ENSG00000198019.12
GeneCardsiFCGR1B
H-InvDBiHIX0028931
HGNCiHGNC:3614 FCGR1B
MIMi601502 gene
neXtProtiNX_Q92637
OpenTargetsiENSG00000198019
PharmGKBiPA28061
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVK2 Eukaryota
ENOG410YF57 LUCA
GeneTreeiENSGT00760000119130
HOGENOMiHOG000251632
HOVERGENiHBG051602
InParanoidiQ92637
PhylomeDBiQ92637
TreeFamiTF335097

Enzyme and pathway databases

ReactomeiR-HSA-1236978 Cross-presentation of soluble exogenous antigens (endosomes)
R-HSA-877300 Interferon gamma signaling

Miscellaneous databases

GenomeRNAii2210
PROiPR:Q92637
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198019 Expressed in 90 organ(s), highest expression level in blood
CleanExiHS_FCGR1B
ExpressionAtlasiQ92637 baseline and differential
GenevisibleiQ92637 HS

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 1 hit
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFCGRB_HUMAN
AccessioniPrimary (citable) accession number: Q92637
Secondary accession number(s): Q7KZ13, Q92638
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: February 1, 1997
Last modified: September 12, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again