Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 207 (26 Feb 2020)
Sequence version 1 (01 Feb 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Heat shock protein 105 kDa

Gene

HSPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering client/substrate protein release (PubMed:24318877). Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processStress response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3000484 Scavenging by Class F Receptors
R-HSA-3371453 Regulation of HSF1-mediated heat shock response

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92598

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Heat shock protein 105 kDa
Alternative name(s):
Antigen NY-CO-25
Heat shock 110 kDa protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HSPH1
Synonyms:HSP105, HSP110, KIAA0201
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16969 HSPH1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610703 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92598

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10808

Open Targets

More...
OpenTargetsi
ENSG00000120694

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134869917

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q92598 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3706560

Drug and drug target database

More...
DrugBanki
DB12695 Phenethyl Isothiocyanate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HSPH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2495344

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000782842 – 858Heat shock protein 105 kDaAdd BLAST857

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei471N6-acetyllysineBy similarity1
Modified residuei509PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei561PhosphothreonineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Modified residuei815PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation on Ser-509 may be important for regulation of the HSPA8/HSC70 chaperone activity.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-526
CPTAC-527

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92598

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92598

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q92598

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92598

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92598

PeptideAtlas

More...
PeptideAtlasi
Q92598

PRoteomics IDEntifications database

More...
PRIDEi
Q92598

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5525
75344 [Q92598-1]
75345 [Q92598-2]
75346 [Q92598-3]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
Q92598

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92598

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92598

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q92598

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120694 Expressed in frontal cortex and 231 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92598 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92598 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002060
HPA028675
HPA031569

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HSPA8/HSC70 (By similarity).

Interacts with HSPA1A (via NBD) and HSPA1B (via NBD) (PubMed:24318877).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116022, 147 interactors

Protein interaction database and analysis system

More...
IntActi
Q92598, 56 interactors

Molecular INTeraction database

More...
MINTi
Q92598

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318687

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q92598 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1858
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92598

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0103 Eukaryota
COG0443 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159635

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005965_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92598

KEGG Orthology (KO)

More...
KOi
K09485

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEPIVTQ

Database of Orthologous Groups

More...
OrthoDBi
406172at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92598

TreeFam database of animal gene trees

More...
TreeFami
TF105043

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11739 HSPH1_NBD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.10, 1 hit
2.60.34.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
IPR042053 HSPH1_NBD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00012 HSP70, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100920 SSF100920, 1 hit
SSF100934 SSF100934, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01036 HSP70_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: Q92598-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVVGLDVGS QSCYIAVARA GGIETIANEF SDRCTPSVIS FGSKNRTIGV
60 70 80 90 100
AAKNQQITHA NNTVSNFKRF HGRAFNDPFI QKEKENLSYD LVPLKNGGVG
110 120 130 140 150
IKVMYMGEEH LFSVEQITAM LLTKLKETAE NSLKKPVTDC VISVPSFFTD
160 170 180 190 200
AERRSVLDAA QIVGLNCLRL MNDMTAVALN YGIYKQDLPS LDEKPRIVVF
210 220 230 240 250
VDMGHSAFQV SACAFNKGKL KVLGTAFDPF LGGKNFDEKL VEHFCAEFKT
260 270 280 290 300
KYKLDAKSKI RALLRLYQEC EKLKKLMSSN STDLPLNIEC FMNDKDVSGK
310 320 330 340 350
MNRSQFEELC AELLQKIEVP LYSLLEQTHL KVEDVSAVEI VGGATRIPAV
360 370 380 390 400
KERIAKFFGK DISTTLNADE AVARGCALQC AILSPAFKVR EFSVTDAVPF
410 420 430 440 450
PISLIWNHDS EDTEGVHEVF SRNHAAPFSK VLTFLRRGPF ELEAFYSDPQ
460 470 480 490 500
GVPYPEAKIG RFVVQNVSAQ KDGEKSRVKV KVRVNTHGIF TISTASMVEK
510 520 530 540 550
VPTEENEMSS EADMECLNQR PPENPDTDKN VQQDNSEAGT QPQVQTDAQQ
560 570 580 590 600
TSQSPPSPEL TSEENKIPDA DKANEKKVDQ PPEAKKPKIK VVNVELPIEA
610 620 630 640 650
NLVWQLGKDL LNMYIETEGK MIMQDKLEKE RNDAKNAVEE YVYEFRDKLC
660 670 680 690 700
GPYEKFICEQ DHQNFLRLLT ETEDWLYEEG EDQAKQAYVD KLEELMKIGT
710 720 730 740 750
PVKVRFQEAE ERPKMFEELG QRLQHYAKIA ADFRNKDEKY NHIDESEMKK
760 770 780 790 800
VEKSVNEVME WMNNVMNAQA KKSLDQDPVV RAQEIKTKIK ELNNTCEPVV
810 820 830 840 850
TQPKPKIESP KLERTPNGPN IDKKEEDLED KNNFGAEPPH QNGECYPNEK

NSVNMDLD
Length:858
Mass (Da):96,865
Last modified:February 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD0E757970E340B56
GO
Isoform Beta (identifier: Q92598-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-572: Missing.

Show »
Length:814
Mass (Da):92,116
Checksum:i10272B4D373289E8
GO
Isoform 3 (identifier: Q92598-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-144: Missing.

Show »
Length:817
Mass (Da):92,255
Checksum:i19C55A76242953F2
GO
Isoform 4 (identifier: Q92598-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP → MATAAVLRGPAAHWVESFQKAREEGSGSGTWRGRWRRR

Show »
Length:860
Mass (Da):97,460
Checksum:i39535248100C9B9C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSM0A0A0A0MSM0_HUMAN
Heat shock protein 105 kDa
HSPH1
782Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBM3Q5TBM3_HUMAN
Heat shock protein 105 kDa
HSPH1
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN69R4GN69_HUMAN
Heat shock protein 105 kDa
HSPH1
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC18044 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA13192 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0548831 – 36MSVVG…DRCTP → MATAAVLRGPAAHWVESFQK AREEGSGSGTWRGRWRRR in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035428104 – 144Missing in isoform 3. CuratedAdd BLAST41
Alternative sequenceiVSP_002428529 – 572Missing in isoform Beta. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB003333 mRNA Translation: BAA34779.1
AB003334 mRNA Translation: BAA34780.1
AF039695 mRNA Translation: AAC18044.1 Different initiation.
D86956 mRNA Translation: BAA13192.2 Different initiation.
AK302430 mRNA Translation: BAG63733.1
AL137142 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08479.1
CH471075 Genomic DNA Translation: EAX08482.1
BC037553 mRNA Translation: AAH37553.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS66525.1 [Q92598-2]
CCDS66526.1 [Q92598-4]
CCDS9340.1 [Q92598-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273432.1, NM_001286503.1 [Q92598-2]
NP_001273433.1, NM_001286504.1 [Q92598-4]
NP_001273434.1, NM_001286505.1
NP_006635.2, NM_006644.3 [Q92598-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000320027; ENSP00000318687; ENSG00000120694 [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694 [Q92598-2]
ENST00000630972; ENSP00000487365; ENSG00000120694 [Q92598-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10808

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10808

UCSC genome browser

More...
UCSCi
uc001utj.5 human [Q92598-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003333 mRNA Translation: BAA34779.1
AB003334 mRNA Translation: BAA34780.1
AF039695 mRNA Translation: AAC18044.1 Different initiation.
D86956 mRNA Translation: BAA13192.2 Different initiation.
AK302430 mRNA Translation: BAG63733.1
AL137142 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08479.1
CH471075 Genomic DNA Translation: EAX08482.1
BC037553 mRNA Translation: AAH37553.1
CCDSiCCDS66525.1 [Q92598-2]
CCDS66526.1 [Q92598-4]
CCDS9340.1 [Q92598-1]
RefSeqiNP_001273432.1, NM_001286503.1 [Q92598-2]
NP_001273433.1, NM_001286504.1 [Q92598-4]
NP_001273434.1, NM_001286505.1
NP_006635.2, NM_006644.3 [Q92598-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6GFAX-ray2.00A1-380[»]
SMRiQ92598
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi116022, 147 interactors
IntActiQ92598, 56 interactors
MINTiQ92598
STRINGi9606.ENSP00000318687

Chemistry databases

ChEMBLiCHEMBL3706560
DrugBankiDB12695 Phenethyl Isothiocyanate

PTM databases

iPTMnetiQ92598
PhosphoSitePlusiQ92598
SwissPalmiQ92598

Polymorphism and mutation databases

BioMutaiHSPH1
DMDMi2495344

2D gel databases

REPRODUCTION-2DPAGEiQ92598

Proteomic databases

CPTACiCPTAC-526
CPTAC-527
EPDiQ92598
jPOSTiQ92598
MassIVEiQ92598
MaxQBiQ92598
PaxDbiQ92598
PeptideAtlasiQ92598
PRIDEiQ92598
ProteomicsDBi5525
75344 [Q92598-1]
75345 [Q92598-2]
75346 [Q92598-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10808

Genome annotation databases

EnsembliENST00000320027; ENSP00000318687; ENSG00000120694 [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694 [Q92598-2]
ENST00000630972; ENSP00000487365; ENSG00000120694 [Q92598-4]
GeneIDi10808
KEGGihsa:10808
UCSCiuc001utj.5 human [Q92598-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10808
DisGeNETi10808

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HSPH1
HGNCiHGNC:16969 HSPH1
HPAiCAB002060
HPA028675
HPA031569
MIMi610703 gene
neXtProtiNX_Q92598
OpenTargetsiENSG00000120694
PharmGKBiPA134869917

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0103 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00940000159635
HOGENOMiCLU_005965_5_1_1
InParanoidiQ92598
KOiK09485
OMAiCEPIVTQ
OrthoDBi406172at2759
PhylomeDBiQ92598
TreeFamiTF105043

Enzyme and pathway databases

ReactomeiR-HSA-3000484 Scavenging by Class F Receptors
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
SIGNORiQ92598

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HSPH1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HSPH1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10808
PharosiQ92598 Tbio

Protein Ontology

More...
PROi
PR:Q92598
RNActiQ92598 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120694 Expressed in frontal cortex and 231 other tissues
ExpressionAtlasiQ92598 baseline and differential
GenevisibleiQ92598 HS

Family and domain databases

CDDicd11739 HSPH1_NBD, 1 hit
Gene3Di1.20.1270.10, 1 hit
2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
IPR042053 HSPH1_NBD
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
SUPFAMiSSF100920 SSF100920, 1 hit
SSF100934 SSF100934, 2 hits
PROSITEiView protein in PROSITE
PS01036 HSP70_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHS105_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92598
Secondary accession number(s): B4DYH1
, O95739, Q5TBM6, Q5TBM7, Q5TBM8, Q9UPC4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: February 26, 2020
This is version 207 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again