Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock protein 105 kDa

Gene

HSPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering client/substrate protein release (PubMed:24318877). Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities (By similarity).By similarity1 Publication

GO - Molecular functioni

  • adenyl-nucleotide exchange factor activity Source: UniProtKB
  • alpha-tubulin binding Source: Ensembl
  • ATP binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processStress response
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-3000484 Scavenging by Class F Receptors
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
SIGNORiQ92598

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock protein 105 kDa
Alternative name(s):
Antigen NY-CO-25
Heat shock 110 kDa protein
Gene namesi
Name:HSPH1
Synonyms:HSP105, HSP110, KIAA0201
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000120694.19
HGNCiHGNC:16969 HSPH1
MIMi610703 gene
neXtProtiNX_Q92598

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi10808
OpenTargetsiENSG00000120694
PharmGKBiPA134869917

Chemistry databases

ChEMBLiCHEMBL3706560

Polymorphism and mutation databases

DMDMi2495344

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000782842 – 858Heat shock protein 105 kDaAdd BLAST857

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei471N6-acetyllysineBy similarity1
Modified residuei509PhosphoserineBy similarity1
Modified residuei510PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei561PhosphothreonineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Modified residuei815PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylation on Ser-509 may be important for regulation of the HSPA8/HSC70 chaperone activity.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ92598
MaxQBiQ92598
PaxDbiQ92598
PeptideAtlasiQ92598
PRIDEiQ92598
ProteomicsDBi75344
75345 [Q92598-2]
75346 [Q92598-3]

2D gel databases

REPRODUCTION-2DPAGEiQ92598

PTM databases

iPTMnetiQ92598
PhosphoSitePlusiQ92598
SwissPalmiQ92598

Miscellaneous databases

PMAP-CutDBiQ92598

Expressioni

Tissue specificityi

Highly expressed in testis. Present at lower levels in most brain regions, except cerebellum. Overexpressed in cancer cells.2 Publications

Gene expression databases

BgeeiENSG00000120694 Expressed in 232 organ(s), highest expression level in frontal cortex
CleanExiHS_HSPH1
ExpressionAtlasiQ92598 baseline and differential
GenevisibleiQ92598 HS

Organism-specific databases

HPAiCAB002060
HPA028675
HPA031569

Interactioni

Subunit structurei

Interacts with HSPA8/HSC70 (By similarity). Interacts with HSPA1A (via NBD) and HSPA1B (via NBD) (PubMed:24318877).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116022, 101 interactors
IntActiQ92598, 44 interactors
MINTiQ92598
STRINGi9606.ENSP00000318687

Structurei

3D structure databases

ProteinModelPortaliQ92598
SMRiQ92598
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the heat shock protein 70 family.Curated

Phylogenomic databases

eggNOGiKOG0103 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00390000016919
HOGENOMiHOG000228138
HOVERGENiHBG047955
InParanoidiQ92598
KOiK09485
OMAiMNDMTAV
OrthoDBiEOG091G04Y6
PhylomeDBiQ92598
TreeFamiTF105043

Family and domain databases

Gene3Di1.20.1270.10, 1 hit
2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 2 hits
SSF100934 SSF100934, 2 hits
PROSITEiView protein in PROSITE
PS01036 HSP70_3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform Alpha (identifier: Q92598-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVVGLDVGS QSCYIAVARA GGIETIANEF SDRCTPSVIS FGSKNRTIGV
60 70 80 90 100
AAKNQQITHA NNTVSNFKRF HGRAFNDPFI QKEKENLSYD LVPLKNGGVG
110 120 130 140 150
IKVMYMGEEH LFSVEQITAM LLTKLKETAE NSLKKPVTDC VISVPSFFTD
160 170 180 190 200
AERRSVLDAA QIVGLNCLRL MNDMTAVALN YGIYKQDLPS LDEKPRIVVF
210 220 230 240 250
VDMGHSAFQV SACAFNKGKL KVLGTAFDPF LGGKNFDEKL VEHFCAEFKT
260 270 280 290 300
KYKLDAKSKI RALLRLYQEC EKLKKLMSSN STDLPLNIEC FMNDKDVSGK
310 320 330 340 350
MNRSQFEELC AELLQKIEVP LYSLLEQTHL KVEDVSAVEI VGGATRIPAV
360 370 380 390 400
KERIAKFFGK DISTTLNADE AVARGCALQC AILSPAFKVR EFSVTDAVPF
410 420 430 440 450
PISLIWNHDS EDTEGVHEVF SRNHAAPFSK VLTFLRRGPF ELEAFYSDPQ
460 470 480 490 500
GVPYPEAKIG RFVVQNVSAQ KDGEKSRVKV KVRVNTHGIF TISTASMVEK
510 520 530 540 550
VPTEENEMSS EADMECLNQR PPENPDTDKN VQQDNSEAGT QPQVQTDAQQ
560 570 580 590 600
TSQSPPSPEL TSEENKIPDA DKANEKKVDQ PPEAKKPKIK VVNVELPIEA
610 620 630 640 650
NLVWQLGKDL LNMYIETEGK MIMQDKLEKE RNDAKNAVEE YVYEFRDKLC
660 670 680 690 700
GPYEKFICEQ DHQNFLRLLT ETEDWLYEEG EDQAKQAYVD KLEELMKIGT
710 720 730 740 750
PVKVRFQEAE ERPKMFEELG QRLQHYAKIA ADFRNKDEKY NHIDESEMKK
760 770 780 790 800
VEKSVNEVME WMNNVMNAQA KKSLDQDPVV RAQEIKTKIK ELNNTCEPVV
810 820 830 840 850
TQPKPKIESP KLERTPNGPN IDKKEEDLED KNNFGAEPPH QNGECYPNEK

NSVNMDLD
Length:858
Mass (Da):96,865
Last modified:February 1, 1997 - v1
Checksum:iD0E757970E340B56
GO
Isoform Beta (identifier: Q92598-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     529-572: Missing.

Show »
Length:814
Mass (Da):92,116
Checksum:i10272B4D373289E8
GO
Isoform 3 (identifier: Q92598-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-144: Missing.

Note: No experimental confirmation available.
Show »
Length:817
Mass (Da):92,255
Checksum:i19C55A76242953F2
GO
Isoform 4 (identifier: Q92598-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTP → MATAAVLRGPAAHWVESFQKAREEGSGSGTWRGRWRRR

Note: No experimental confirmation available.
Show »
Length:860
Mass (Da):97,460
Checksum:i39535248100C9B9C
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSM0A0A0A0MSM0_HUMAN
Heat shock protein 105 kDa
HSPH1
782Annotation score:
Q5TBM3Q5TBM3_HUMAN
Heat shock protein 105 kDa
HSPH1
115Annotation score:
R4GN69R4GN69_HUMAN
Heat shock protein 105 kDa
HSPH1
115Annotation score:

Sequence cautioni

The sequence AAC18044 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA13192 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548831 – 36MSVVG…DRCTP → MATAAVLRGPAAHWVESFQK AREEGSGSGTWRGRWRRR in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035428104 – 144Missing in isoform 3. CuratedAdd BLAST41
Alternative sequenceiVSP_002428529 – 572Missing in isoform Beta. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003333 mRNA Translation: BAA34779.1
AB003334 mRNA Translation: BAA34780.1
AF039695 mRNA Translation: AAC18044.1 Different initiation.
D86956 mRNA Translation: BAA13192.2 Different initiation.
AK302430 mRNA Translation: BAG63733.1
AL137142 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08479.1
CH471075 Genomic DNA Translation: EAX08482.1
BC037553 mRNA Translation: AAH37553.1
CCDSiCCDS66525.1 [Q92598-2]
CCDS66526.1 [Q92598-4]
CCDS9340.1 [Q92598-1]
RefSeqiNP_001273432.1, NM_001286503.1 [Q92598-2]
NP_001273433.1, NM_001286504.1 [Q92598-4]
NP_001273434.1, NM_001286505.1
NP_006635.2, NM_006644.3 [Q92598-1]
UniGeneiHs.743267

Genome annotation databases

EnsembliENST00000320027; ENSP00000318687; ENSG00000120694 [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694 [Q92598-2]
ENST00000630972; ENSP00000487365; ENSG00000120694 [Q92598-4]
GeneIDi10808
KEGGihsa:10808
UCSCiuc001utj.5 human [Q92598-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003333 mRNA Translation: BAA34779.1
AB003334 mRNA Translation: BAA34780.1
AF039695 mRNA Translation: AAC18044.1 Different initiation.
D86956 mRNA Translation: BAA13192.2 Different initiation.
AK302430 mRNA Translation: BAG63733.1
AL137142 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08479.1
CH471075 Genomic DNA Translation: EAX08482.1
BC037553 mRNA Translation: AAH37553.1
CCDSiCCDS66525.1 [Q92598-2]
CCDS66526.1 [Q92598-4]
CCDS9340.1 [Q92598-1]
RefSeqiNP_001273432.1, NM_001286503.1 [Q92598-2]
NP_001273433.1, NM_001286504.1 [Q92598-4]
NP_001273434.1, NM_001286505.1
NP_006635.2, NM_006644.3 [Q92598-1]
UniGeneiHs.743267

3D structure databases

ProteinModelPortaliQ92598
SMRiQ92598
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116022, 101 interactors
IntActiQ92598, 44 interactors
MINTiQ92598
STRINGi9606.ENSP00000318687

Chemistry databases

ChEMBLiCHEMBL3706560

PTM databases

iPTMnetiQ92598
PhosphoSitePlusiQ92598
SwissPalmiQ92598

Polymorphism and mutation databases

DMDMi2495344

2D gel databases

REPRODUCTION-2DPAGEiQ92598

Proteomic databases

EPDiQ92598
MaxQBiQ92598
PaxDbiQ92598
PeptideAtlasiQ92598
PRIDEiQ92598
ProteomicsDBi75344
75345 [Q92598-2]
75346 [Q92598-3]

Protocols and materials databases

DNASUi10808
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320027; ENSP00000318687; ENSG00000120694 [Q92598-1]
ENST00000380405; ENSP00000369768; ENSG00000120694 [Q92598-2]
ENST00000630972; ENSP00000487365; ENSG00000120694 [Q92598-4]
GeneIDi10808
KEGGihsa:10808
UCSCiuc001utj.5 human [Q92598-1]

Organism-specific databases

CTDi10808
DisGeNETi10808
EuPathDBiHostDB:ENSG00000120694.19
GeneCardsiHSPH1
HGNCiHGNC:16969 HSPH1
HPAiCAB002060
HPA028675
HPA031569
MIMi610703 gene
neXtProtiNX_Q92598
OpenTargetsiENSG00000120694
PharmGKBiPA134869917
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0103 Eukaryota
COG0443 LUCA
GeneTreeiENSGT00390000016919
HOGENOMiHOG000228138
HOVERGENiHBG047955
InParanoidiQ92598
KOiK09485
OMAiMNDMTAV
OrthoDBiEOG091G04Y6
PhylomeDBiQ92598
TreeFamiTF105043

Enzyme and pathway databases

ReactomeiR-HSA-3000484 Scavenging by Class F Receptors
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
SIGNORiQ92598

Miscellaneous databases

ChiTaRSiHSPH1 human
GeneWikiiHSPH1
GenomeRNAii10808
PMAP-CutDBiQ92598
PROiPR:Q92598
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120694 Expressed in 232 organ(s), highest expression level in frontal cortex
CleanExiHS_HSPH1
ExpressionAtlasiQ92598 baseline and differential
GenevisibleiQ92598 HS

Family and domain databases

Gene3Di1.20.1270.10, 1 hit
2.60.34.10, 1 hit
InterProiView protein in InterPro
IPR018181 Heat_shock_70_CS
IPR029048 HSP70_C_sf
IPR029047 HSP70_peptide-bd_sf
IPR013126 Hsp_70_fam
PANTHERiPTHR19375 PTHR19375, 1 hit
PfamiView protein in Pfam
PF00012 HSP70, 1 hit
PRINTSiPR00301 HEATSHOCK70
SUPFAMiSSF100920 SSF100920, 2 hits
SSF100934 SSF100934, 2 hits
PROSITEiView protein in PROSITE
PS01036 HSP70_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHS105_HUMAN
AccessioniPrimary (citable) accession number: Q92598
Secondary accession number(s): B4DYH1
, O95739, Q5TBM6, Q5TBM7, Q5TBM8, Q9UPC4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: September 12, 2018
This is version 195 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again