Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (13 Feb 2019)
Sequence version 2 (01 May 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium/hydrogen exchanger 6

Gene

SLC9A6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Electroneutral exchange of protons for Na+ and K+ across the early and recycling endosome membranes. Contributes to calcium homeostasis.

Caution

Was originally (PubMed:9507001) identified as a mitochondrial inner membrane protein, but was later shown to be localized in early and recycling endosomes and not mitochondria (PubMed:11940519).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAntiport, Ion transport, Sodium transport, Transport
LigandSodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-425986 Sodium/Proton exchangers
R-HSA-5619092 Defective SLC9A6 causes X-linked, syndromic mental retardation, Christianson type (MRXSCH)

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.36.1.14 the monovalent cation:proton antiporter-1 (cpa1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/hydrogen exchanger 6
Alternative name(s):
Na(+)/H(+) exchanger 6
Short name:
NHE-6
Solute carrier family 9 member 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC9A6
Synonyms:KIAA0267, NHE6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000198689.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11079 SLC9A6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300231 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92581

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei28 – 48HelicalSequence analysisAdd BLAST21
Transmembranei71 – 91HelicalSequence analysisAdd BLAST21
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Transmembranei142 – 162HelicalSequence analysisAdd BLAST21
Transmembranei179 – 199HelicalSequence analysisAdd BLAST21
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Transmembranei246 – 266HelicalSequence analysisAdd BLAST21
Transmembranei292 – 312HelicalSequence analysisAdd BLAST21
Transmembranei340 – 360HelicalSequence analysisAdd BLAST21
Transmembranei382 – 402HelicalSequence analysisAdd BLAST21
Transmembranei404 – 424HelicalSequence analysisAdd BLAST21
Transmembranei447 – 467HelicalSequence analysisAdd BLAST21
Transmembranei483 – 503HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, X-linked, syndromic, Christianson type (MRXSCH)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA syndrome characterized by profound mental retardation, epilepsy, ataxia, and microcephaly. It shows phenotypic overlap with Angelman syndrome.
See also OMIM:300243

Keywords - Diseasei

Epilepsy, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10479

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
SLC9A6

MalaCards human disease database

More...
MalaCardsi
SLC9A6
MIMi300243 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000198689

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
85278 Christianson syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35935

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC9A6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6919937

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000523621 – 669Sodium/hydrogen exchanger 6Add BLAST669

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi128N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki443Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Keywords - PTMi

Glycoprotein, Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92581

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92581

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92581

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92581

PeptideAtlas

More...
PeptideAtlasi
Q92581

PRoteomics IDEntifications database

More...
PRIDEi
Q92581

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75339
75340 [Q92581-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92581

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92581

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q92581

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198689 Expressed in 234 organ(s), highest expression level in postcentral gyrus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92581 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92581 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA059445
HPA059590

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115742, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q92581, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359729

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q92581

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92581

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1965 Eukaryota
COG0025 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153460

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000172307

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055575

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92581

KEGG Orthology (KO)

More...
KOi
K12041

Identification of Orthologs from Complete Genome Data

More...
OMAi
QGDNSHT

Database of Orthologous Groups

More...
OrthoDBi
559433at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92581

TreeFam database of animal gene trees

More...
TreeFami
TF318755

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006153 Cation/H_exchanger
IPR018422 Cation/H_exchanger_CPA1
IPR002090 Na/H_exchanger_6
IPR004709 NaH_exchanger

The PANTHER Classification System

More...
PANTHERi
PTHR10110 PTHR10110, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00999 Na_H_Exchanger, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01084 NAHEXCHNGR
PR01088 NAHEXCHNGR6

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00840 b_cpa1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92581-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARRGWRRAP LRRGVGSSPR ARRLMRPLWL LLAVGVFDWA GASDGGGGEA
60 70 80 90 100
RAMDEEIVSE KQAEESHRQD SANLLIFILL LTLTILTIWL FKHRRARFLH
110 120 130 140 150
ETGLAMIYGL LVGLVLRYGI HVPSDVNNVT LSCEVQSSPT TLLVTFDPEV
160 170 180 190 200
FFNILLPPII FYAGYSLKRR HFFRNLGSIL AYAFLGTAIS CFVIGSIMYG
210 220 230 240 250
CVTLMKVTGQ LAGDFYFTDC LLFGAIVSAT DPVTVLAIFH ELQVDVELYA
260 270 280 290 300
LLFGESVLND AVAIVLSSSI VAYQPAGDNS HTFDVTAMFK SIGIFLGIFS
310 320 330 340 350
GSFAMGAATG VVTALVTKFT KLREFQLLET GLFFLMSWST FLLAEAWGFT
360 370 380 390 400
GVVAVLFCGI TQAHYTYNNL STESQHRTKQ LFELLNFLAE NFIFSYMGLT
410 420 430 440 450
LFTFQNHVFN PTFVVGAFVA IFLGRAANIY PLSLLLNLGR RSKIGSNFQH
460 470 480 490 500
MMMFAGLRGA MAFALAIRDT ATYARQMMFS TTLLIVFFTV WVFGGGTTAM
510 520 530 540 550
LSCLHIRVGV DSDQEHLGVP ENERRTTKAE SAWLFRMWYN FDHNYLKPLL
560 570 580 590 600
THSGPPLTTT LPACCGPIAR CLTSPQAYEN QEQLKDDDSD LILNDGDISL
610 620 630 640 650
TYGDSTVNTE PATSSAPRRF MGNSSEDALD RELAFGDHEL VIRGTRLVLP
660
MDDSEPPLNL LDNTRHGPA
Length:669
Mass (Da):74,162
Last modified:May 1, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF6416596229F2639
GO
Isoform 2 (identifier: Q92581-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

Show »
Length:701
Mass (Da):77,917
Checksum:iA2BE0E4EF07A62EC
GO
Isoform 3 (identifier: Q92581-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     144-144: V → VNVSGKFYEYMLKGEISSHELNNVQDNEMLRKV

Note: No experimental confirmation available.
Show »
Length:649
Mass (Da):72,260
Checksum:iF875E7739A25438F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GV11A0A1B0GV11_HUMAN
Sodium/hydrogen exchanger
SLC9A6
617Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SGH0A0A0D9SGH0_HUMAN
Sodium/hydrogen exchanger
SLC9A6
679Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GW29A0A1B0GW29_HUMAN
Sodium/hydrogen exchanger 6
SLC9A6
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SFM4A0A0D9SFM4_HUMAN
Sodium/hydrogen exchanger 6
SLC9A6
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTT2A0A1B0GTT2_HUMAN
Sodium/hydrogen exchanger 6
SLC9A6
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti20R → G in AAH35029 (PubMed:15489334).Curated1
Sequence conflicti92K → E in BAF82464 (PubMed:14702039).Curated1
Sequence conflicti144V → I in BAH14626 (PubMed:14702039).Curated1
Sequence conflicti307A → T in BAH14626 (PubMed:14702039).Curated1
Sequence conflicti372T → M in BAF82464 (PubMed:14702039).Curated1
Sequence conflicti373E → G in BAG62192 (PubMed:14702039).Curated1
Sequence conflicti634A → S in BAF82464 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0448681 – 52Missing in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_042030144V → VNVSGKFYEYMLKGEISSHE LNNVQDNEMLRKV in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF030409 mRNA Translation: AAC39643.1
AK289775 mRNA Translation: BAF82464.1
AK300475 mRNA Translation: BAG62192.1
AK316255 mRNA Translation: BAH14626.1
AL732579 Genomic DNA No translation available.
BC035029 mRNA Translation: AAH35029.1
BC049169 mRNA Translation: AAH49169.1
D87743 mRNA Translation: BAA13449.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14654.1 [Q92581-1]
CCDS44003.1 [Q92581-2]
CCDS55504.1 [Q92581-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001036002.1, NM_001042537.1 [Q92581-2]
NP_001171122.1, NM_001177651.1 [Q92581-3]
NP_006350.1, NM_006359.2 [Q92581-1]
XP_006724789.1, XM_006724726.3 [Q92581-3]
XP_016884712.1, XM_017029223.1 [Q92581-3]
XP_016884713.1, XM_017029224.1 [Q92581-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.62185

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370695; ENSP00000359729; ENSG00000198689 [Q92581-2]
ENST00000370698; ENSP00000359732; ENSG00000198689 [Q92581-1]
ENST00000370701; ENSP00000359735; ENSG00000198689 [Q92581-3]
ENST00000636092; ENSP00000490406; ENSG00000198689 [Q92581-3]
ENST00000636347; ENSP00000490648; ENSG00000198689 [Q92581-3]
ENST00000637234; ENSP00000490527; ENSG00000198689 [Q92581-3]
ENST00000637581; ENSP00000490731; ENSG00000198689 [Q92581-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10479

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10479

UCSC genome browser

More...
UCSCi
uc004ezj.3 human [Q92581-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030409 mRNA Translation: AAC39643.1
AK289775 mRNA Translation: BAF82464.1
AK300475 mRNA Translation: BAG62192.1
AK316255 mRNA Translation: BAH14626.1
AL732579 Genomic DNA No translation available.
BC035029 mRNA Translation: AAH35029.1
BC049169 mRNA Translation: AAH49169.1
D87743 mRNA Translation: BAA13449.1
CCDSiCCDS14654.1 [Q92581-1]
CCDS44003.1 [Q92581-2]
CCDS55504.1 [Q92581-3]
RefSeqiNP_001036002.1, NM_001042537.1 [Q92581-2]
NP_001171122.1, NM_001177651.1 [Q92581-3]
NP_006350.1, NM_006359.2 [Q92581-1]
XP_006724789.1, XM_006724726.3 [Q92581-3]
XP_016884712.1, XM_017029223.1 [Q92581-3]
XP_016884713.1, XM_017029224.1 [Q92581-3]
UniGeneiHs.62185

3D structure databases

ProteinModelPortaliQ92581
SMRiQ92581
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115742, 33 interactors
IntActiQ92581, 1 interactor
STRINGi9606.ENSP00000359729

Protein family/group databases

TCDBi2.A.36.1.14 the monovalent cation:proton antiporter-1 (cpa1) family

PTM databases

iPTMnetiQ92581
PhosphoSitePlusiQ92581
SwissPalmiQ92581

Polymorphism and mutation databases

BioMutaiSLC9A6
DMDMi6919937

Proteomic databases

EPDiQ92581
jPOSTiQ92581
MaxQBiQ92581
PaxDbiQ92581
PeptideAtlasiQ92581
PRIDEiQ92581
ProteomicsDBi75339
75340 [Q92581-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370695; ENSP00000359729; ENSG00000198689 [Q92581-2]
ENST00000370698; ENSP00000359732; ENSG00000198689 [Q92581-1]
ENST00000370701; ENSP00000359735; ENSG00000198689 [Q92581-3]
ENST00000636092; ENSP00000490406; ENSG00000198689 [Q92581-3]
ENST00000636347; ENSP00000490648; ENSG00000198689 [Q92581-3]
ENST00000637234; ENSP00000490527; ENSG00000198689 [Q92581-3]
ENST00000637581; ENSP00000490731; ENSG00000198689 [Q92581-3]
GeneIDi10479
KEGGihsa:10479
UCSCiuc004ezj.3 human [Q92581-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10479
DisGeNETi10479
EuPathDBiHostDB:ENSG00000198689.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC9A6
GeneReviewsiSLC9A6
HGNCiHGNC:11079 SLC9A6
HPAiHPA059445
HPA059590
MalaCardsiSLC9A6
MIMi300231 gene
300243 phenotype
neXtProtiNX_Q92581
OpenTargetsiENSG00000198689
Orphaneti85278 Christianson syndrome
PharmGKBiPA35935

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1965 Eukaryota
COG0025 LUCA
GeneTreeiENSGT00940000153460
HOGENOMiHOG000172307
HOVERGENiHBG055575
InParanoidiQ92581
KOiK12041
OMAiQGDNSHT
OrthoDBi559433at2759
PhylomeDBiQ92581
TreeFamiTF318755

Enzyme and pathway databases

ReactomeiR-HSA-425986 Sodium/Proton exchangers
R-HSA-5619092 Defective SLC9A6 causes X-linked, syndromic mental retardation, Christianson type (MRXSCH)

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC9A6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10479

Protein Ontology

More...
PROi
PR:Q92581

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198689 Expressed in 234 organ(s), highest expression level in postcentral gyrus
ExpressionAtlasiQ92581 baseline and differential
GenevisibleiQ92581 HS

Family and domain databases

InterProiView protein in InterPro
IPR006153 Cation/H_exchanger
IPR018422 Cation/H_exchanger_CPA1
IPR002090 Na/H_exchanger_6
IPR004709 NaH_exchanger
PANTHERiPTHR10110 PTHR10110, 2 hits
PfamiView protein in Pfam
PF00999 Na_H_Exchanger, 1 hit
PRINTSiPR01084 NAHEXCHNGR
PR01088 NAHEXCHNGR6
TIGRFAMsiTIGR00840 b_cpa1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSL9A6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92581
Secondary accession number(s): A6NIQ9
, A8K160, B4DU30, B7ZAE0, Q3ZCW7, Q5JPP8, Q5JPP9, Q86VS0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: February 13, 2019
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again