Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DCN1-like protein 4

Gene

DCUN1D4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • cullin family protein binding Source: GO_Central
  • ubiquitin conjugating enzyme binding Source: GO_Central
  • ubiquitin-like protein binding Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation

Names & Taxonomyi

Protein namesi
Recommended name:
DCN1-like protein 4
Alternative name(s):
DCUN1 domain-containing protein 4
Defective in cullin neddylation protein 1-like protein 4
Gene namesi
Name:DCUN1D4
Synonyms:KIAA0276
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000109184.14
HGNCiHGNC:28998 DCUN1D4
MIMi612977 gene
neXtProtiNX_Q92564

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000109184
PharmGKBiPA142672010

Polymorphism and mutation databases

DMDMi78099237

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001295031 – 292DCN1-like protein 4Add BLAST292

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki95Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ92564
MaxQBiQ92564
PaxDbiQ92564
PeptideAtlasiQ92564
PRIDEiQ92564
ProteomicsDBi75320
75321 [Q92564-2]

PTM databases

iPTMnetiQ92564
PhosphoSitePlusiQ92564

Expressioni

Gene expression databases

BgeeiENSG00000109184 Expressed in 226 organ(s), highest expression level in corpus callosum
CleanExiHS_DCUN1D4
ExpressionAtlasiQ92564 baseline and differential
GenevisibleiQ92564 HS

Organism-specific databases

HPAiHPA036483
HPA036484

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
P299913EBI-2654610,EBI-8826488From Dengue virus type 2 (strain 16681-PDK53).

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116759, 18 interactors
IntActiQ92564, 2 interactors
STRINGi9606.ENSP00000334625

Structurei

Secondary structure

1292
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ92564
SMRiQ92564
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini101 – 287DCUN1PROSITE-ProRule annotationAdd BLAST187

Phylogenomic databases

eggNOGiKOG3077 Eukaryota
ENOG410XTIJ LUCA
GeneTreeiENSGT00550000074529
HOGENOMiHOG000241761
HOVERGENiHBG106637
InParanoidiQ92564
KOiK17824
OMAiEPTNFKL
OrthoDBiEOG091G0L81
PhylomeDBiQ92564
TreeFamiTF354270

Family and domain databases

InterProiView protein in InterPro
IPR014764 DCN-prot
IPR005176 PONY_dom
PANTHERiPTHR12281 PTHR12281, 1 hit
PfamiView protein in Pfam
PF03556 Cullin_binding, 1 hit
PROSITEiView protein in PROSITE
PS51229 DCUN1, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92564-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHSDAAAVNF QLNSHLSTLA NIHKIYHTLN KLNLTEDIGQ DDHQTGSLRS
60 70 80 90 100
CSSSDCFNKV MPPRKKRRPA SGDDLSAKKS RHDSMYRKYD STRIKTEEEA
110 120 130 140 150
FSSKRCLEWF YEYAGTDDVV GPEGMEKFCE DIGVEPENVV MLVLAWKLDA
160 170 180 190 200
QNMGYFTLQE WLKGMTSLQC DTTEKLRNTL DYLRSFLNDS TNFKLIYRYA
210 220 230 240 250
FDFAREKDQR SLDINTAKCM LGLLLGKIWP LFPVFHQFLE QSKYKVINKD
260 270 280 290
QWCNVLEFSR TINLDLSNYD EDGAWPVLLD EFVEWYKDKQ MS
Length:292
Mass (Da):34,068
Last modified:October 25, 2005 - v2
Checksum:i1927AA612E075E9C
GO
Isoform 2 (identifier: Q92564-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     206-240: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):29,984
Checksum:i0090D4A1D4E7314C
GO
Isoform 3 (identifier: Q92564-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MHSDAAAVN → MEVEAALGCSGQGRGCGGVAPAGRGRERASERGTRVRISKGLSGAGGSVRKAD

Note: No experimental confirmation available.
Show »
Length:336
Mass (Da):38,382
Checksum:iB1ABCAA676927798
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RDV8D6RDV8_HUMAN
DCN1-like protein
DCUN1D4
212Annotation score:
H0YA35H0YA35_HUMAN
DCN1-like protein
DCUN1D4
102Annotation score:
D6RB33D6RB33_HUMAN
DCN1-like protein
DCUN1D4 hCG_21420
143Annotation score:
H0Y907H0Y907_HUMAN
DCN1-like protein
DCUN1D4
116Annotation score:
D6RAL8D6RAL8_HUMAN
DCN1-like protein
DCUN1D4
207Annotation score:
D6RGX7D6RGX7_HUMAN
DCN1-like protein 4
DCUN1D4
63Annotation score:
H0Y9C5H0Y9C5_HUMAN
DCN1-like protein 4
DCUN1D4
21Annotation score:
D6RCB7D6RCB7_HUMAN
DCN1-like protein 4
DCUN1D4
24Annotation score:
D6RIY3D6RIY3_HUMAN
DCN1-like protein 4
DCUN1D4
46Annotation score:

Sequence cautioni

The sequence BAA13405 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD97912 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0543811 – 9MHSDAAAVN → MEVEAALGCSGQGRGCGGVA PAGRGRERASERGTRVRISK GLSGAGGSVRKAD in isoform 3. 1 Publication9
Alternative sequenceiVSP_016016206 – 240Missing in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA Translation: BAA13405.1 Different initiation.
AK294894 mRNA Translation: BAG57986.1
BX537944 mRNA Translation: CAD97912.1 Different initiation.
AC027271 Genomic DNA No translation available.
BC053897 mRNA Translation: AAH53897.2
CCDSiCCDS33982.1 [Q92564-1]
CCDS3487.2 [Q92564-2]
CCDS75123.1 [Q92564-3]
RefSeqiNP_001035492.1, NM_001040402.2 [Q92564-1]
NP_001274684.1, NM_001287755.1 [Q92564-3]
NP_001274686.1, NM_001287757.1
NP_055930.2, NM_015115.3 [Q92564-2]
UniGeneiHs.605388

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184 [Q92564-1]
ENST00000381441; ENSP00000370850; ENSG00000109184 [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184 [Q92564-3]
GeneIDi23142
KEGGihsa:23142
UCSCiuc003gze.5 human [Q92564-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA Translation: BAA13405.1 Different initiation.
AK294894 mRNA Translation: BAG57986.1
BX537944 mRNA Translation: CAD97912.1 Different initiation.
AC027271 Genomic DNA No translation available.
BC053897 mRNA Translation: AAH53897.2
CCDSiCCDS33982.1 [Q92564-1]
CCDS3487.2 [Q92564-2]
CCDS75123.1 [Q92564-3]
RefSeqiNP_001035492.1, NM_001040402.2 [Q92564-1]
NP_001274684.1, NM_001287755.1 [Q92564-3]
NP_001274686.1, NM_001287757.1
NP_055930.2, NM_015115.3 [Q92564-2]
UniGeneiHs.605388

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5V89X-ray1.55A102-292[»]
ProteinModelPortaliQ92564
SMRiQ92564
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116759, 18 interactors
IntActiQ92564, 2 interactors
STRINGi9606.ENSP00000334625

PTM databases

iPTMnetiQ92564
PhosphoSitePlusiQ92564

Polymorphism and mutation databases

DMDMi78099237

Proteomic databases

EPDiQ92564
MaxQBiQ92564
PaxDbiQ92564
PeptideAtlasiQ92564
PRIDEiQ92564
ProteomicsDBi75320
75321 [Q92564-2]

Protocols and materials databases

DNASUi23142
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184 [Q92564-1]
ENST00000381441; ENSP00000370850; ENSG00000109184 [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184 [Q92564-3]
GeneIDi23142
KEGGihsa:23142
UCSCiuc003gze.5 human [Q92564-1]

Organism-specific databases

CTDi23142
EuPathDBiHostDB:ENSG00000109184.14
GeneCardsiDCUN1D4
HGNCiHGNC:28998 DCUN1D4
HPAiHPA036483
HPA036484
MIMi612977 gene
neXtProtiNX_Q92564
OpenTargetsiENSG00000109184
PharmGKBiPA142672010
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3077 Eukaryota
ENOG410XTIJ LUCA
GeneTreeiENSGT00550000074529
HOGENOMiHOG000241761
HOVERGENiHBG106637
InParanoidiQ92564
KOiK17824
OMAiEPTNFKL
OrthoDBiEOG091G0L81
PhylomeDBiQ92564
TreeFamiTF354270

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation

Miscellaneous databases

ChiTaRSiDCUN1D4 human
GeneWikiiDCUN1D4
GenomeRNAii23142
PROiPR:Q92564
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109184 Expressed in 226 organ(s), highest expression level in corpus callosum
CleanExiHS_DCUN1D4
ExpressionAtlasiQ92564 baseline and differential
GenevisibleiQ92564 HS

Family and domain databases

InterProiView protein in InterPro
IPR014764 DCN-prot
IPR005176 PONY_dom
PANTHERiPTHR12281 PTHR12281, 1 hit
PfamiView protein in Pfam
PF03556 Cullin_binding, 1 hit
PROSITEiView protein in PROSITE
PS51229 DCUN1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDCNL4_HUMAN
AccessioniPrimary (citable) accession number: Q92564
Secondary accession number(s): B4DH25, Q7Z3F3, Q7Z6B8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: November 7, 2018
This is version 136 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again