Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q92564 (DCNL4_HUMAN)

Entry version 154 (23 Feb 2022)
Sequence version 2 (25 Oct 2005)
Previous versions | rss
Add a publicationFeedback
Protein

DCN1-like protein 4

Gene

DCUN1D4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs).

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q92564

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8951664, Neddylation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q92564

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DCN1-like protein 4Curated
Short name:
DCNL41 Publication
Alternative name(s):
DCUN1 domain-containing protein 4
Defective in cullin neddylation protein 1-like protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DCUN1D4Imported
Synonyms:KIAA0276
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28998, DCUN1D4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612977, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q92564

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000109184

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi250D → A: Does not affect localization at nucleus; when associated with R-274 and A-280. 1 Publication1
Mutagenesisi274A → R: Does not affect localization at nucleus; when associated with A-250 and A-280. 1 Publication1
Mutagenesisi280D → A: Does not affect localization at nucleus; when associated with A-250 and R-274. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		23142

Open Targets

More...OpenTargetsi		ENSG00000109184

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142672010

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q92564, Tdark

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295914

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		DCUN1D4

Domain mapping of disease mutations (DMDM)

More...DMDMi		78099237

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001295031 – 292DCN1-like protein 4Add BLAST292

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki95Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q92564

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q92564

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q92564

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q92564

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q92564

PeptideAtlas

More...PeptideAtlasi		Q92564

PRoteomics IDEntifications database

More...PRIDEi		Q92564

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4184
75320 [Q92564-1]
75321 [Q92564-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q92564

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q92564

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000109184, Expressed in calcaneal tendon and 237 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q92564, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q92564, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000109184, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via the DCUN1 domain) with the unneddylated cullins: interacts with CUL1, CUL2, CUL3, CUL4A, CUL4B and CUL5; these interactions promote the cullin neddylation and the identity of the cullin dictates the affinity of the interaction (PubMed:26906416, PubMed:23201271).

Interacts with RBX1 and RNF7 (PubMed:26906416).

Interacts with CAND1; this interaction is bridged by cullins such as CUL3 and strongly inhibits the neddylation of CUL3. These CAND-cullin-DCNL complexes can only be neddylated in the presence of a substrate adapter (PubMed:26906416).

Interacts (via DCUN1 domain) with UBE2M (N-terminally acetylated form) and probably with UBE2F (N-terminally acetylated form) (PubMed:23201271).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116759, 22 interactors

Protein interaction database and analysis system

More...IntActi		Q92564, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000389900

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q92564

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q92564, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1292
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q92564

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini101 – 287DCUN1PROSITE-ProRule annotationAdd BLAST187

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni43 – 83DisorderedSequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi43 – 57Polar residuesSequence analysisAdd BLAST15
Compositional biasi60 – 83Basic and acidic residuesSequence analysisAdd BLAST24

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DCUN1 domain, also known as PONY domain, mediates the interaction with different cullins (PubMed:23201271). The DCUN1 domain mediates the interaction with the N-terminally acetylated NEDD8-conjugating E2s enzyme leading to the NEDD8 transfer from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes; the neddylation efficiency correlates with the DCUN1D5-cullin and DCUN1D5-E2 interaction affinities (PubMed:23201271).1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3077, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156935

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_047042_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q92564

Identification of Orthologs from Complete Genome Data

More...OMAi		VEWYKEK

Database of Orthologous Groups

More...OrthoDBi		1418097at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q92564

TreeFam database of animal gene trees

More...TreeFami		TF354270

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.238.200, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR014764, DCN-prot
IPR042460, DCN1-like_PONY
IPR005176, PONY_dom

The PANTHER Classification System

More...PANTHERi		PTHR12281, PTHR12281, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03556, Cullin_binding, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51229, DCUN1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92564-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHSDAAAVNF QLNSHLSTLA NIHKIYHTLN KLNLTEDIGQ DDHQTGSLRS 
        60         70         80         90        100
CSSSDCFNKV MPPRKKRRPA SGDDLSAKKS RHDSMYRKYD STRIKTEEEA 
       110        120        130        140        150
FSSKRCLEWF YEYAGTDDVV GPEGMEKFCE DIGVEPENVV MLVLAWKLDA 
       160        170        180        190        200
QNMGYFTLQE WLKGMTSLQC DTTEKLRNTL DYLRSFLNDS TNFKLIYRYA 
       210        220        230        240        250
FDFAREKDQR SLDINTAKCM LGLLLGKIWP LFPVFHQFLE QSKYKVINKD 
       260        270        280        290 
QWCNVLEFSR TINLDLSNYD EDGAWPVLLD EFVEWYKDKQ MS
Length:292
Mass (Da):34,068
Last modified:October 25, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1927AA612E075E9C
GO
Isoform 2 (identifier: Q92564-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     206-240: Missing.

Show »
Length:257
Mass (Da):29,984
Checksum:i0090D4A1D4E7314C
GO
Isoform 3 (identifier: Q92564-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MHSDAAAVN → MEVEAALGCSGQGRGCGGVAPAGRGRERASERGTRVRISKGLSGAGGSVRKAD

Show »
Length:336
Mass (Da):38,382
Checksum:iB1ABCAA676927798
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RDV8D6RDV8_HUMAN
DCN1-like protein
DCUN1D4
212Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB33D6RB33_HUMAN
DCN1-like protein
DCUN1D4 hCG_21420
143Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAL8D6RAL8_HUMAN
DCN1-like protein
DCUN1D4
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA35H0YA35_HUMAN
DCN1-like protein
DCUN1D4
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y907H0Y907_HUMAN
DCN1-like protein
DCUN1D4
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGX7D6RGX7_HUMAN
DCN1-like protein 4
DCUN1D4
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9C5H0Y9C5_HUMAN
DCN1-like protein 4
DCUN1D4
21Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCB7D6RCB7_HUMAN
DCN1-like protein 4
DCUN1D4
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RIY3D6RIY3_HUMAN
DCN1-like protein 4
DCUN1D4
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA13405 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD97912 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0543811 – 9MHSDAAAVN → MEVEAALGCSGQGRGCGGVA PAGRGRERASERGTRVRISK GLSGAGGSVRKAD in isoform 3. 1 Publication9
Alternative sequenceiVSP_016016206 – 240Missing in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D87466 mRNA Translation: BAA13405.1 Different initiation.
AK294894 mRNA Translation: BAG57986.1
BX537944 mRNA Translation: CAD97912.1 Different initiation.
AC027271 Genomic DNA No translation available.
BC053897 mRNA Translation: AAH53897.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33982.1 [Q92564-1]
CCDS3487.2 [Q92564-2]
CCDS75123.1 [Q92564-3]

NCBI Reference Sequences

More...RefSeqi		NP_001035492.1, NM_001040402.2 [Q92564-1]
NP_001274684.1, NM_001287755.1 [Q92564-3]
NP_001274686.1, NM_001287757.1
NP_055930.2, NM_015115.3 [Q92564-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000334635; ENSP00000334625; ENSG00000109184
ENST00000381441; ENSP00000370850; ENSG00000109184 [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184 [Q92564-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23142

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23142

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000334635.10; ENSP00000334625.5; NM_001040402.3; NP_001035492.1

UCSC genome browser

More...UCSCi		uc003gze.5, human [Q92564-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87466 mRNA Translation: BAA13405.1 Different initiation.
AK294894 mRNA Translation: BAG57986.1
BX537944 mRNA Translation: CAD97912.1 Different initiation.
AC027271 Genomic DNA No translation available.
BC053897 mRNA Translation: AAH53897.2
CCDSiCCDS33982.1 [Q92564-1]
CCDS3487.2 [Q92564-2]
CCDS75123.1 [Q92564-3]
RefSeqiNP_001035492.1, NM_001040402.2 [Q92564-1]
NP_001274684.1, NM_001287755.1 [Q92564-3]
NP_001274686.1, NM_001287757.1
NP_055930.2, NM_015115.3 [Q92564-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5V89X-ray1.55A102-292[»]
SMRiQ92564
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116759, 22 interactors
IntActiQ92564, 4 interactors
STRINGi9606.ENSP00000389900

Chemistry databases

BindingDBiQ92564
ChEMBLiCHEMBL4295914

PTM databases

iPTMnetiQ92564
PhosphoSitePlusiQ92564

Genetic variation databases

BioMutaiDCUN1D4
DMDMi78099237

Proteomic databases

EPDiQ92564
jPOSTiQ92564
MassIVEiQ92564
MaxQBiQ92564
PaxDbiQ92564
PeptideAtlasiQ92564
PRIDEiQ92564
ProteomicsDBi4184
75320 [Q92564-1]
75321 [Q92564-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		23882, 109 antibodies from 17 providers

The DNASU plasmid repository

More...DNASUi		23142

Genome annotation databases

EnsembliENST00000334635; ENSP00000334625; ENSG00000109184
ENST00000381441; ENSP00000370850; ENSG00000109184 [Q92564-2]
ENST00000451288; ENSP00000389900; ENSG00000109184 [Q92564-3]
GeneIDi23142
KEGGihsa:23142
MANE-SelectiENST00000334635.10; ENSP00000334625.5; NM_001040402.3; NP_001035492.1
UCSCiuc003gze.5, human [Q92564-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23142
DisGeNETi23142

GeneCards: human genes, protein and diseases

More...GeneCardsi		DCUN1D4
HGNCiHGNC:28998, DCUN1D4
HPAiENSG00000109184, Low tissue specificity
MIMi612977, gene
neXtProtiNX_Q92564
OpenTargetsiENSG00000109184
PharmGKBiPA142672010
VEuPathDBiHostDB:ENSG00000109184

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3077, Eukaryota
GeneTreeiENSGT00940000156935
HOGENOMiCLU_047042_3_1_1
InParanoidiQ92564
OMAiVEWYKEK
OrthoDBi1418097at2759
PhylomeDBiQ92564
TreeFamiTF354270

Enzyme and pathway databases

PathwayCommonsiQ92564
ReactomeiR-HSA-8951664, Neddylation
SignaLinkiQ92564

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23142, 10 hits in 1047 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		DCUN1D4, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		DCUN1D4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23142
PharosiQ92564, Tdark

Protein Ontology

More...PROi		PR:Q92564
RNActiQ92564, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000109184, Expressed in calcaneal tendon and 237 other tissues
ExpressionAtlasiQ92564, baseline and differential
GenevisibleiQ92564, HS

Family and domain databases

Gene3Di1.10.238.200, 1 hit
InterProiView protein in InterPro
IPR014764, DCN-prot
IPR042460, DCN1-like_PONY
IPR005176, PONY_dom
PANTHERiPTHR12281, PTHR12281, 1 hit
PfamiView protein in Pfam
PF03556, Cullin_binding, 1 hit
PROSITEiView protein in PROSITE
PS51229, DCUN1, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDCNL4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92564
Secondary accession number(s): B4DH25, Q7Z3F3, Q7Z6B8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 25, 2005
Last modified: February 23, 2022
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again