Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (18 Sep 2019)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tripartite motif-containing protein 66

Gene

Trim66

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as transcription repressor; The repressive effects are mediated, at least in part, by recruitment of deacetylase activity. May play a role as negative regulator of postmeiotic genes acting through CBX3 complex formation and centromere association.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri1 – 46B box-type 1; atypicalPROSITE-ProRule annotationAdd BLAST46
Zinc fingeri60 – 101B box-type 2PROSITE-ProRule annotationAdd BLAST42
Zinc fingeri996 – 1043PHD-typePROSITE-ProRule annotationAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tripartite motif-containing protein 66
Alternative name(s):
Transcriptional intermediary factor 1 delta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Trim66
Synonyms:Tif1d
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2152406 Trim66

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi889V → A: Drastic decrease of CBX5, CBX1 and CBX3 binding; When associated with A-891. 1 Publication1
Mutagenesisi891L → A: Drastic decrease of CBX5, CBX1 and CBX3 binding; When associated with A-889. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002203761 – 1242Tripartite motif-containing protein 66Add BLAST1242

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q924W6

PRoteomics IDEntifications database

More...
PRIDEi
Q924W6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q924W6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q924W6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominant in testis, specifically in elongating spermatids.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

No significant expression in testis of 2- or 3-week-old mouse, but clear detection at the age of 4 weeks.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031026 Expressed in 87 organ(s), highest expression level in lumbar subsegment of spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q924W6 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form homodimers and heterodimers.

Interacts with CBX5, CBX1 and CBX3 via PxVxL motif.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
236997, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000102352

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q924W6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1084 – 1156BromoPROSITE-ProRule annotationAdd BLAST73

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili130 – 200Sequence analysisAdd BLAST71

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi887 – 891PxVxL motif5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi329 – 493Pro-richAdd BLAST165

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1 – 46B box-type 1; atypicalPROSITE-ProRule annotationAdd BLAST46
Zinc fingeri60 – 101B box-type 2PROSITE-ProRule annotationAdd BLAST42
Zinc fingeri996 – 1043PHD-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Bromodomain, Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2177 Eukaryota
ENOG41106NJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159240

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000074104

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q924W6

KEGG Orthology (KO)

More...
KOi
K12032

Database of Orthologous Groups

More...
OrthoDBi
756911at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00021 BBOX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.920.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003649 Bbox_C
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR037372 Trim66
IPR019786 Zinc_finger_PHD-type_CS
IPR000315 Znf_B-box
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger

The PANTHER Classification System

More...
PANTHERi
PTHR45915:SF7 PTHR45915:SF7, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00439 Bromodomain, 1 hit
PF00628 PHD, 1 hit
PF00643 zf-B_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00502 BBC, 1 hit
SM00336 BBOX, 2 hits
SM00297 BROMO, 1 hit
SM00249 PHD, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS50119 ZF_BBOX, 2 hits
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q924W6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARNCSECKE KRAAHILCTY CNRWLCSSCT EEHRHVPAPG GPLFARAQKG
60 70 80 90 100
SSGVNGGSGD FALYCPLHTQ EVLKLFCETC DVLTCHSCLM VEHKEHRCRH
110 120 130 140 150
VEEVLQNQRM LLESVTSQVA HKKSSLQTSA KQIEDRIFEV KHQHRKVENQ
160 170 180 190 200
IKMAKMVLMN ELNKQANGLI EELEGITNER KRKLEQQLQS IMVLNRQFEH
210 220 230 240 250
VQNFINWAVC SKSSVPFLFS KELIVFQMQR LLETRCNTDP GSPWSIRFTW
260 270 280 290 300
EPNFWTKQLA SLGCITTEGG QLTRADAAAA SYGSLQGQPS FYQSHQAPMA
310 320 330 340 350
QQEALSHPSH KFQSPALCSS SVCCSHCSPV SPSLKGQVPP PSIHPAHSFR
360 370 380 390 400
QPSEMVPHQL GSLQCSTLLP REKELACSPH PPKLMQPWLE PQPPAEQEST
410 420 430 440 450
SQRPGPQLVS QPVCIVPPQD VQPGAHAQPT IQTPSIQVQL GHHQKLKLSH
460 470 480 490 500
FQQQPQQQPP PPPPPPPPPQ HAPPPLPPSQ HLASSQHESP PGPACSQNVD
510 520 530 540 550
IMHHKFELEE MQKDLELLLQ AQQPSLQLSQ TKSPQHLQQT IVGQINYIVR
560 570 580 590 600
QPAPVQSQSQ EETLQVTEEP PAPEGPKPAL PVDKNTAAPL PQTSGEETPH
610 620 630 640 650
SVPPVDGTSQ HSSPNVVRKH ATSVSIMGFS NTVEMELSST RLARTIEPQI
660 670 680 690 700
HRVSSLTAAP THTIPSLLSG PPQTVSSLMS VSNHAMPSLT ASHLQPVPNL
710 720 730 740 750
VRGTFQSTSN LRGDSSQAIT GLASNHSQAG PSLMSGHTQA APSLATCPLQ
760 770 780 790 800
GMPPVSDVHV EPRSVSSPGS GPAAESLGTR DGAESSLGNA LCKMESEDCT
810 820 830 840 850
RFSDSVGQGP TASSLDGPKD LAIPSELEEP INLSVKKPFL APVINTSTAL
860 870 880 890 900
QQYRNPKEYE NFEQGALELD TKENSDIRAI SSEPKIPYVR LERLKICAAS
910 920 930 940 950
SGEMPVFKLK PQKNSQDGNF LLVIECGTES SSMSIKVSQN SLPDASQGPG
960 970 980 990 1000
LGGRKVTVTS LTGQQPQEVE STSEEHRLIP RAPGAKKNTP APIENEDFCA
1010 1020 1030 1040 1050
VCINGGELLC CDRCPKVYHL SCHVPALLSF PGGEWVCTLC RSLTQPEMEY
1060 1070 1080 1090 1100
DCENARYGHP GVRVLPGLSM YDQKKCEKLV LSLCCNSLSL PFHEPVSPLA
1110 1120 1130 1140 1150
RHYYQIIKRP MDLSIIRRKL QKKDPAHYTT PEEVVSDVRL MFWNCAKFNY
1160 1170 1180 1190 1200
PDSEVAEAGR CLEVFFEGWL KEIYPDKCFA QPQQEDSDSE DVSGESGCST
1210 1220 1230 1240
PQGFPWPPYM QEGIQPKRRR RHMENEKTKR VSFRLANSIS QV
Length:1,242
Mass (Da):136,766
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i98606ACB8BA70243
GO
Isoform 2 (identifier: Q924W6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-98: Missing.
     794-825: MESEDCTRFSDSVGQGPTASSLDGPKDLAIPS → V

Show »
Length:1,209
Mass (Da):133,325
Checksum:iA09AE83390F46D6C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PZP2E9PZP2_MOUSE
Tripartite motif-containing protein...
Trim66
1,233Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QLR8E9QLR8_MOUSE
Tripartite motif-containing protein...
Trim66
1,344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti43L → I in AAS78677 (PubMed:15322135).Curated1
Sequence conflicti818P → S in AAS78677 (PubMed:15322135).Curated1
Sequence conflicti879A → T in AAS78677 (PubMed:15322135).Curated1
Sequence conflicti919N → S in AAS78677 (PubMed:15322135).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02655597 – 98Missing in isoform 2. Curated2
Alternative sequenceiVSP_026556794 – 825MESED…LAIPS → V in isoform 2. CuratedAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ307670 Genomic DNA Translation: CAC38114.1
AY572455 mRNA Translation: AAS78677.1
AC124457 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40082.1 [Q924W6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_862901.3, NM_181853.4 [Q924W6-1]
XP_006508022.1, XM_006507959.1 [Q924W6-1]
XP_006508023.1, XM_006507960.2 [Q924W6-1]
XP_006508024.1, XM_006507961.3 [Q924W6-1]
XP_006508025.1, XM_006507962.1 [Q924W6-1]
XP_011240137.1, XM_011241835.2 [Q924W6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000033339; ENSMUSP00000033339; ENSMUSG00000031026 [Q924W6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
330627

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:330627

UCSC genome browser

More...
UCSCi
uc012fsa.1 mouse [Q924W6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ307670 Genomic DNA Translation: CAC38114.1
AY572455 mRNA Translation: AAS78677.1
AC124457 Genomic DNA No translation available.
CCDSiCCDS40082.1 [Q924W6-1]
RefSeqiNP_862901.3, NM_181853.4 [Q924W6-1]
XP_006508022.1, XM_006507959.1 [Q924W6-1]
XP_006508023.1, XM_006507960.2 [Q924W6-1]
XP_006508024.1, XM_006507961.3 [Q924W6-1]
XP_006508025.1, XM_006507962.1 [Q924W6-1]
XP_011240137.1, XM_011241835.2 [Q924W6-1]

3D structure databases

SMRiQ924W6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi236997, 4 interactors
STRINGi10090.ENSMUSP00000102352

PTM databases

iPTMnetiQ924W6
PhosphoSitePlusiQ924W6

Proteomic databases

PaxDbiQ924W6
PRIDEiQ924W6

Genome annotation databases

EnsembliENSMUST00000033339; ENSMUSP00000033339; ENSMUSG00000031026 [Q924W6-1]
GeneIDi330627
KEGGimmu:330627
UCSCiuc012fsa.1 mouse [Q924W6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9866
MGIiMGI:2152406 Trim66

Phylogenomic databases

eggNOGiKOG2177 Eukaryota
ENOG41106NJ LUCA
GeneTreeiENSGT00940000159240
HOGENOMiHOG000074104
InParanoidiQ924W6
KOiK12032
OrthoDBi756911at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q924W6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031026 Expressed in 87 organ(s), highest expression level in lumbar subsegment of spinal cord
ExpressionAtlasiQ924W6 baseline and differential

Family and domain databases

CDDicd00021 BBOX, 1 hit
Gene3Di1.20.920.10, 1 hit
InterProiView protein in InterPro
IPR003649 Bbox_C
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR037372 Trim66
IPR019786 Zinc_finger_PHD-type_CS
IPR000315 Znf_B-box
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
PANTHERiPTHR45915:SF7 PTHR45915:SF7, 1 hit
PfamiView protein in Pfam
PF00439 Bromodomain, 1 hit
PF00628 PHD, 1 hit
PF00643 zf-B_box, 1 hit
SMARTiView protein in SMART
SM00502 BBC, 1 hit
SM00336 BBOX, 2 hits
SM00297 BROMO, 1 hit
SM00249 PHD, 2 hits
SUPFAMiSSF47370 SSF47370, 1 hit
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 1 hit
PS50119 ZF_BBOX, 2 hits
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRI66_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q924W6
Secondary accession number(s): E9QKN7, Q5SEK4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: July 27, 2011
Last modified: September 18, 2019
This is version 126 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again