Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-like protein family member 11B

Gene

Rasl11b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi39 – 46GTPBy similarity8
Nucleotide bindingi86 – 93GTPBy similarity8
Nucleotide bindingi151 – 154GTPBy similarity4

GO - Molecular functioni

  • GTPase activity Source: InterPro
  • GTP binding Source: UniProtKB-KW
  • transforming growth factor beta receptor binding Source: MGI

GO - Biological processi

Keywordsi

LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-like protein family member 11B
Gene namesi
Name:Rasl11bImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1916189 Rasl11b

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003083661 – 247Ras-like protein family member 11BAdd BLAST247

Proteomic databases

PaxDbiQ922H7
PRIDEiQ922H7

PTM databases

iPTMnetiQ922H7
PhosphoSitePlusiQ922H7

Expressioni

Gene expression databases

BgeeiENSMUSG00000049907 Expressed in 266 organ(s), highest expression level in olfactory bulb
CleanExiMM_RASL11B
GenevisibleiQ922H7 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000053389

Structurei

3D structure databases

ProteinModelPortaliQ922H7
SMRiQ922H7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni28 – 245Small GTPase-likeAdd BLAST218

Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Sequence analysis

Phylogenomic databases

eggNOGiKOG0395 Eukaryota
COG1100 LUCA
GeneTreeiENSGT00930000150874
HOGENOMiHOG000233973
HOVERGENiHBG108422
InParanoidiQ922H7
KOiK07853
OMAiMLGCTFY
OrthoDBiEOG091G0M6D
PhylomeDBiQ922H7
TreeFamiTF318030

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
IPR020849 Small_GTPase_Ras-type
PANTHERiPTHR24070 PTHR24070, 1 hit
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51421 RAS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 11 Publication (identifier: Q922H7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLIQNMCTI AEYPAPGSTA ADCCLGAAGR RLVKIAVVGA SGVGKTALVV
60 70 80 90 100
RFLTKRFIGD YERNAGNLYT RQVHIEGETL AIQVQDTPGI QVHENGLSCS
110 120 130 140 150
EQLNRCIRWA DAVVLVFSIT DHKSYELISQ LHQHVQQLHP GTRLPVVLVA
160 170 180 190 200
NKADLLHVKQ VDPQLGLQLA SMLGCSFYEV SVSENYNDVY NAFHVLCKEV
210 220 230 240
SPKQQPSSTP EKRRTSLIPR PKSPNMQDLK RRFKQALSAK VRTVTSV
Length:247
Mass (Da):27,362
Last modified:December 1, 2001 - v1
Checksum:i58B70AF005718538
GO
Isoform 21 Publication (identifier: Q922H7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: Missing.
     60-90: DYERNAGNLYTRQVHIEGETLAIQVQDTPGI → MKGSFELRDVLWPELSAVPTASCSPCSPSSP

Note: No experimental confirmation available.Curated
Show »
Length:188
Mass (Da):21,033
Checksum:iCB2FE5086990A8DA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti224P → L in BAB23353 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0525851 – 59Missing in isoform 2. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_05258660 – 90DYERN…DTPGI → MKGSFELRDVLWPELSAVPT ASCSPCSPSSP in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004534 mRNA Translation: BAB23353.1
BC008101 mRNA Translation: AAH08101.1
BC083068 mRNA Translation: AAH83068.1
BK001707 mRNA Translation: DAA02249.1
CCDSiCCDS39113.1 [Q922H7-1]
RefSeqiNP_081154.1, NM_026878.1 [Q922H7-1]
UniGeneiMm.293316

Genome annotation databases

EnsembliENSMUST00000051937; ENSMUSP00000053389; ENSMUSG00000049907 [Q922H7-1]
GeneIDi68939
KEGGimmu:68939
UCSCiuc008xtj.1 mouse [Q922H7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004534 mRNA Translation: BAB23353.1
BC008101 mRNA Translation: AAH08101.1
BC083068 mRNA Translation: AAH83068.1
BK001707 mRNA Translation: DAA02249.1
CCDSiCCDS39113.1 [Q922H7-1]
RefSeqiNP_081154.1, NM_026878.1 [Q922H7-1]
UniGeneiMm.293316

3D structure databases

ProteinModelPortaliQ922H7
SMRiQ922H7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000053389

PTM databases

iPTMnetiQ922H7
PhosphoSitePlusiQ922H7

Proteomic databases

PaxDbiQ922H7
PRIDEiQ922H7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000051937; ENSMUSP00000053389; ENSMUSG00000049907 [Q922H7-1]
GeneIDi68939
KEGGimmu:68939
UCSCiuc008xtj.1 mouse [Q922H7-1]

Organism-specific databases

CTDi65997
MGIiMGI:1916189 Rasl11b

Phylogenomic databases

eggNOGiKOG0395 Eukaryota
COG1100 LUCA
GeneTreeiENSGT00930000150874
HOGENOMiHOG000233973
HOVERGENiHBG108422
InParanoidiQ922H7
KOiK07853
OMAiMLGCTFY
OrthoDBiEOG091G0M6D
PhylomeDBiQ922H7
TreeFamiTF318030

Miscellaneous databases

PROiPR:Q922H7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000049907 Expressed in 266 organ(s), highest expression level in olfactory bulb
CleanExiMM_RASL11B
GenevisibleiQ922H7 MM

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
IPR020849 Small_GTPase_Ras-type
PANTHERiPTHR24070 PTHR24070, 1 hit
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51421 RAS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRSLBB_MOUSE
AccessioniPrimary (citable) accession number: Q922H7
Secondary accession number(s): Q9D0S0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again