Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bicaudal D homolog 2

Gene

Bicd2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates and stabilizes the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (PubMed:11483508, PubMed:25035494, PubMed:24986880, PubMed:22956769). Facilitates the binding of RAB6A to the Golgi by stabilizing its GTP-bound form (PubMed:25962623). Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport via its interaction with RAB6A and recruitment of the dynein-dynactin motor complex (PubMed:12447383, PubMed:25962623). Contributes to nuclear and centrosomal positioning prior to mitotic entry through regulation of both dynein and kinesin-1. During G2 phase of the cell cycle, associates with RANBP2 at the nuclear pores and recruits dynein and dynactin to the nuclear envelope to ensure proper positioning of the nucleus relative to centrosomes prior to the onset of mitosis (PubMed:20386726).7 Publications

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: InterPro
  • dynactin binding Source: UniProtKB
  • dynein complex binding Source: UniProtKB
  • dynein light intermediate chain binding Source: FlyBase
  • Rab GTPase binding Source: BHF-UCL

GO - Biological processi

  • centrosome localization Source: UniProtKB
  • microtubule anchoring at microtubule organizing center Source: BHF-UCL
  • microtubule-based movement Source: MGI
  • minus-end-directed organelle transport along microtubule Source: BHF-UCL
  • mRNA transport Source: UniProtKB-KW
  • protein localization to Golgi apparatus Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • regulation of microtubule cytoskeleton organization Source: MGI
  • retrograde vesicle-mediated transport, Golgi to ER Source: UniProtKB

Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 2
Short name:
Bic-D 2
Gene namesi
Name:Bicd2
Synonyms:Kiaa0699
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1924145 Bicd2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Nuclear pore complex, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002053602 – 820Protein bicaudal D homolog 2Add BLAST819

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei190PhosphoserineBy similarity1
Modified residuei224PhosphoserineBy similarity1
Modified residuei320PhosphoserineBy similarity1
Modified residuei321PhosphothreonineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei397PhosphoserineBy similarity1
Modified residuei570PhosphoserineBy similarity1
Modified residuei578PhosphoserineCombined sources1
Modified residuei598PhosphothreonineBy similarity1
Modified residuei819PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by NEK9 in vitro.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ921C5
PeptideAtlasiQ921C5
PRIDEiQ921C5

PTM databases

iPTMnetiQ921C5
PhosphoSitePlusiQ921C5

Expressioni

Tissue specificityi

Ubiquitously expressed with high expression in the spinal cord.1 Publication

Gene expression databases

BgeeiENSMUSG00000037933
CleanExiMM_BICD2
ExpressionAtlasiQ921C5 baseline and differential
GenevisibleiQ921C5 MM

Interactioni

Subunit structurei

Interacts with CPNE4 (via VWFA domain) (PubMed:12522145). Interacts with NEK9 (By similarity). Interacts with DCTN2 (PubMed:11483508, PubMed:22956769). Interacts with RAB6A (PubMed:12447383, PubMed:25962623). Interacts with DNAI1 (By similarity). Interacts with DYNLL1, DYNC1H1, DYNC1I2 and DCTN1 (PubMed:22956769). Forms a complex with dynein and dynactin (PubMed:24986880). The dynein-dynactin-BICD2 ternary complex (DDB) binds preferentially to tyrosinated microtubules than to detyrosinated microtubules (PubMed:26968983). Interacts with RANBP2, RAB6A and KIF5A (PubMed:20386726). Interacts with KIF1C (By similarity).By similarity9 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: InterPro
  • dynactin binding Source: UniProtKB
  • dynein light intermediate chain binding Source: FlyBase
  • Rab GTPase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi218383, 7 interactors
DIPiDIP-49453N
IntActiQ921C5, 18 interactors
MINTiQ921C5
STRINGi10090.ENSMUSP00000039394

Structurei

3D structure databases

ProteinModelPortaliQ921C5
SMRiQ921C5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni25 – 400Interaction with DYNLL1, DYNC1H1, DYNC1I2, DCTN1 and DCTN21 PublicationAdd BLAST376
Regioni336 – 595Interaction with KIF5A1 PublicationAdd BLAST260
Regioni586 – 820Interaction with RANBP21 PublicationAdd BLAST235
Regioni662 – 810Interaction with RAB6A3 PublicationsAdd BLAST149

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili20 – 270Sequence analysisAdd BLAST251
Coiled coili340 – 539Sequence analysisAdd BLAST200
Coiled coili662 – 804Sequence analysisAdd BLAST143

Domaini

The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.1 Publication

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0999 Eukaryota
ENOG410XR47 LUCA
GeneTreeiENSGT00390000004114
HOGENOMiHOG000261658
HOVERGENiHBG050686
InParanoidiQ921C5
KOiK18739
OMAiDRDSHED
OrthoDBiEOG091G01P4
PhylomeDBiQ921C5
TreeFamiTF323833

Family and domain databases

InterProiView protein in InterPro
IPR018477 BICD
PANTHERiPTHR31233 PTHR31233, 1 hit
PfamiView protein in Pfam
PF09730 BicD, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q921C5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAPSEEEEY ARLVMEAQPE WLRAEVKRLS HELAETTREK IQAAEYGLAV
60 70 80 90 100
LEEKHQLKLQ FEELEVDYEA IRSEMEQLKE AFGQAHTNHK KVAADGESRE
110 120 130 140 150
ESLIQESASK EQYYVRKVLE LQTELKQLRN VLTNTQSENE RLTSVAQELK
160 170 180 190 200
EINQNVEIQR GRLRDDIKEY KFREARLLQD YSELEEENIS LQKQVSVLRQ
210 220 230 240 250
NQVEFEGLKH EIKRLEEETE YLNSQLEDAI RLKEISERQL EEALETLKTE
260 270 280 290 300
REQKNNLRKE LSHYMSINDS FYTSHLQVSL DGLKFSDDTV TAEPNNDAEA
310 320 330 340 350
LVNGFEHSGL VKSSLDNKTS TPRKDGLAPP SPSLVSDLLS ELHISEIQKL
360 370 380 390 400
KQQLVQMERE KVGLLATLQD TQKQLEQARG TLSEQHEKVN RLTENLSALR
410 420 430 440 450
RLQAGKERQT SLDNEKDRDS HEDGDYYEVD INGPEILACK YHVAVAEAGE
460 470 480 490 500
LREQLKALRS THEAREAQHA EEKGRYEAEG QALTEKISLL EKASHQDREL
510 520 530 540 550
LAHLEKELKK VSDVAGETQG SLNVAQDELV TFSEELANLY HHVCMCNNET
560 570 580 590 600
PNRVMLDYYR EGQGKAGRTS PEGRGRRSPV LLPKGLLATE VGRADGGTGD
610 620 630 640 650
NSPSPSSSLP SPLSDPRREP MNIYNLIAII RDQIKHLQAA VDRTTELSRQ
660 670 680 690 700
RIASQELGPA VDKDKEALME EILKLKSLLS TKREQITTLR TVLKANKQTA
710 720 730 740 750
EVALANLKSK YENEKAMVTE TMMKLRNELK ALKEDAATFS SLRAMFATRC
760 770 780 790 800
DEYITQLDEM QRQLAAAEDE KKTLNSLLRM AIQQKLALTQ RLELLELDHE
810 820
QTRRGRSKAA SKAKPASPSL
Length:820
Mass (Da):93,391
Last modified:December 1, 2001 - v1
Checksum:i0C1A1754CD74DDE1
GO
Isoform 2 (identifier: Q921C5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     820-820: L → VSHTCACASERAEGAGLANQVFCSEKHSIYCD

Note: No experimental confirmation available.
Show »
Length:851
Mass (Da):96,647
Checksum:i25A80CD34D97587F
GO
Isoform 3 (identifier: Q921C5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-338: APPSPSLVSDL → VHPLHALCLTV
     339-820: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:338
Mass (Da):39,315
Checksum:iE2DF08B87A283BFE
GO

Sequence cautioni

Isoform 3 : The sequence BAB22282 differs from that shown. Reason: Frameshift at position 70.Curated
The sequence BAC65630 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007971328 – 338APPSPSLVSDL → VHPLHALCLTV in isoform 3. CuratedAdd BLAST11
Alternative sequenceiVSP_007972339 – 820Missing in isoform 3. CuratedAdd BLAST482
Alternative sequenceiVSP_007970820L → VSHTCACASERAEGAGLANQ VFCSEKHSIYCD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250106 mRNA Translation: CAC51393.1
AK122348 mRNA Translation: BAC65630.1 Different initiation.
BC032198 mRNA Translation: AAH32198.1
AK002683 mRNA Translation: BAB22282.1 Frameshift.
AK003456 mRNA Translation: BAC25035.1
CCDSiCCDS36656.1 [Q921C5-1]
CCDS36657.1 [Q921C5-2]
RefSeqiNP_001034268.1, NM_001039179.2 [Q921C5-2]
NP_001034269.1, NM_001039180.2
NP_084067.1, NM_029791.4 [Q921C5-1]
UniGeneiMm.197387

Genome annotation databases

EnsembliENSMUST00000048544; ENSMUSP00000039394; ENSMUSG00000037933 [Q921C5-2]
ENSMUST00000110085; ENSMUSP00000105712; ENSMUSG00000037933 [Q921C5-1]
GeneIDi76895
KEGGimmu:76895
UCSCiuc007qjg.2 mouse [Q921C5-1]
uc007qji.2 mouse [Q921C5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBICD2_MOUSE
AccessioniPrimary (citable) accession number: Q921C5
Secondary accession number(s): Q80TU1, Q8BTE3, Q9DCL3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: December 1, 2001
Last modified: April 25, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health