Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (17 Jun 2020)
Sequence version 2 (04 Jan 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription factor VBP

Gene

TEF

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that binds to and transactivates the vitellogenin II (VTG2) promoter. Binds to the palindromic sequence 5'-GTTTACATAAAC-3'.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor VBP
Alternative name(s):
Thyrotroph embryonic factor homolog
Vitellogenin gene-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TEF
Synonyms:VBP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiGallus gallus (Chicken)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9031 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000539 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi278L → V: Complete loss of binding to VTG2 promoter in isoform 3. 1 Publication1
Mutagenesisi285L → V: Complete loss of binding to VTG2 promoter in isoform 3. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000765161 – 319Transcription factor VBPAdd BLAST319

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92172

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 3 are expressed in a variety of somatic tissues, including liver, heart, intestine, stomach and kidney. Both isoforms are also expressed in hepatoma (LMH) cells and in embryonic fibroblast cell lines. Isoform 2 and isoform 4 are expressed in adult heart and intestine.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 3 is expressed as early as embryonic day 10.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSGALG00000011958 Expressed in cerebellum and 9 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92172 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a homodimer or a heterodimer. Exists as a stable dimer in the absence of DNA.

1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9031.ENSGALP00000037167

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92172

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini243 – 306bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni245 – 265Basic motifPROSITE-ProRule annotationAdd BLAST21
Regioni266 – 273Leucine-zipperPROSITE-ProRule annotation8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi176 – 227Pro-rich (proline/acidic region (PAR))Add BLAST52

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. PAR subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ISY1 Eukaryota
ENOG4111H5X LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156578

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_051922_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92172

KEGG Orthology (KO)

More...
KOi
K09058

Identification of Orthologs from Complete Genome Data

More...
OMAi
GAERNTP

Database of Orthologous Groups

More...
OrthoDBi
1023460at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92172

TreeFam database of animal gene trees

More...
TreeFami
TF315869

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004827 bZIP
IPR040223 PAR_bZIP
IPR029832 TEF/VBP

The PANTHER Classification System

More...
PANTHERi
PTHR11988 PTHR11988, 1 hit
PTHR11988:SF24 PTHR11988:SF24, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07716 bZIP_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00338 BRLZ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50217 BZIP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q92172-1) [UniParc]FASTAAdd to basket
Also known as: Alpha/beta

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGRAAHQEA AAAGGAAAEP TAAGGSAGAV AQQPEQQGLA GAFPLVLKKL
60 70 80 90 100
MENPPRDARL DKEKKIKLEE DEAAAASTMA VSASLMPPIW DKTIPYDGES
110 120 130 140 150
FHLEYMDLDE FLLENGIPSS PTHLDLNQNP LMPVAKLEEK EPASASTGSP
160 170 180 190 200
VSSSSTAVYQ QSEAASSTES PPQNERNTPS PIDPDCVEVE VNFNPDPADL
210 220 230 240 250
VLSSVPGGEL FNPRKHKFTE EDLKPQPMIK KAKKVFVPDE QKDEKYWTRR
260 270 280 290 300
KKNNVAAKRS RDARRLKENQ ITIRAAFLEK ENTALRTEVA ELRKEVGRCK
310
NIVSKYETRY GPFDLSDSE
Note: Produced by alternative promoter usage.
Length:319
Mass (Da):34,954
Last modified:January 4, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i68218FF969A51804
GO
Isoform 2 (identifier: Q92172-2) [UniParc]FASTAAdd to basket
Also known as: Beta/beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MPGRAAHQEA...MENPPRDARL → MSVCNSAGGPAALDFPEVLKSLLEYSLPWTTKMT

Note: Produced by alternative promoter usage.Curated
Show »
Length:293
Mass (Da):32,737
Checksum:iC5803D510CEE03D6
GO
Isoform 3 (identifier: Q92172-3) [UniParc]FASTAAdd to basket
Also known as: Alpha/alpha

The sequence of this isoform differs from the canonical sequence as follows:
     313-319: FDLSDSE → L

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:313
Mass (Da):34,274
Checksum:i26E40276F95CF5BD
GO
Isoform 4 (identifier: Q92172-4) [UniParc]FASTAAdd to basket
Also known as: Beta/alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MPGRAAHQEA...MENPPRDARL → MSVCNSAGGPAALDFPEVLKSLLEYSLPWTTKMT
     313-319: FDLSDSE → L

Note: Produced by alternative splicing of isoform 2.Curated
Show »
Length:287
Mass (Da):32,056
Checksum:i8D36D122AF5282DC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0516421 – 60MPGRA…RDARL → MSVCNSAGGPAALDFPEVLK SLLEYSLPWTTKMT in isoform 2 and isoform 4. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_051643313 – 319FDLSDSE → L in isoform 3 and isoform 4. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U09221 mRNA Translation: AAA82156.1
U09222 Genomic DNA Translation: AAA82157.1
U09223 Genomic DNA Translation: AAA82158.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A41524
S50109

NCBI Reference Sequences

More...
RefSeqi
NP_990713.1, NM_205382.1 [Q92172-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSGALT00000037963; ENSGALP00000037167; ENSGALG00000011958 [Q92172-2]
ENSGALT00000064953; ENSGALP00000048592; ENSGALG00000011958 [Q92172-1]
ENSGALT00000096528; ENSGALP00000071276; ENSGALG00000011958 [Q92172-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
396342

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
gga:396342

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U09221 mRNA Translation: AAA82156.1
U09222 Genomic DNA Translation: AAA82157.1
U09223 Genomic DNA Translation: AAA82158.1
PIRiA41524
S50109
RefSeqiNP_990713.1, NM_205382.1 [Q92172-2]

3D structure databases

SMRiQ92172
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000037167

Proteomic databases

PaxDbiQ92172

Genome annotation databases

EnsembliENSGALT00000037963; ENSGALP00000037167; ENSGALG00000011958 [Q92172-2]
ENSGALT00000064953; ENSGALP00000048592; ENSGALG00000011958 [Q92172-1]
ENSGALT00000096528; ENSGALP00000071276; ENSGALG00000011958 [Q92172-4]
GeneIDi396342
KEGGigga:396342

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7008

Phylogenomic databases

eggNOGiENOG410ISY1 Eukaryota
ENOG4111H5X LUCA
GeneTreeiENSGT00940000156578
HOGENOMiCLU_051922_2_0_1
InParanoidiQ92172
KOiK09058
OMAiGAERNTP
OrthoDBi1023460at2759
PhylomeDBiQ92172
TreeFamiTF315869

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q92172

Gene expression databases

BgeeiENSGALG00000011958 Expressed in cerebellum and 9 other tissues
ExpressionAtlasiQ92172 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
IPR040223 PAR_bZIP
IPR029832 TEF/VBP
PANTHERiPTHR11988 PTHR11988, 1 hit
PTHR11988:SF24 PTHR11988:SF24, 1 hit
PfamiView protein in Pfam
PF07716 bZIP_2, 1 hit
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEF_CHICK
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92172
Secondary accession number(s): Q788X3, Q92057
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: January 4, 2005
Last modified: June 17, 2020
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again