Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Secretoglobin family 3A member 2

Gene

Scgb3a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Secreted cytokine-like protein (By similarity). Binds to the scavenger receptor MARCO (By similarity). Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity). Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919). Seems to have anti-inflammatory effects in respiratory epithelium (PubMed:16456148, PubMed:25242865). Also has anti-fibrotic activity in lung (PubMed:24213919, PubMed:26559674). May play a role in fetal lung development and maturation (PubMed:18535256). Promotes branching morphogenesis during early stages of lung development (PubMed:18535256). In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (PubMed:24514953).By similarity6 Publications

Enzyme and pathway databases

ReactomeiR-MMU-3000480 Scavenging by Class A Receptors

Names & Taxonomyi

Protein namesi
Recommended name:
Secretoglobin family 3A member 2
Alternative name(s):
Pneumo secretory protein 1
Short name:
PnSP-1
Uteroglobin-related protein 1
Gene namesi
Name:Scgb3a2
Synonyms:Pnsp1, Ugrp1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:2153470 Scgb3a2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Disruption phenotypei

Viable and fertile, with no gross abnormalities. Lung tissue appears normal (PubMed:25242865). In a C57BL/6NCr strain background, animals show a mild increase in ovalbumin-induced inflammatory response in lung (PubMed:25242865). However, in a mixed genetic background, there is a reduced ovalbumin-induced inflammatory response, possibly due to the presence of modifier genes (PubMed:25242865). Animals have a more severe response to bleomycin-induced pulmonary fibrosis characterized by increased weight loss, more extensive fibrosis in lung tissue, increased expression of collagen genes, higher numbers of lymphocyte, monocyte and neutrophil cells in bronchoalveolar lavage fluid, and increased cytokine levels (PubMed:26559674).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi68C → S: Fails to homodimerize. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21By similarityAdd BLAST21
ChainiPRO_000003638222 – 91Secretoglobin family 3A member 2Add BLAST70

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi68Interchain1 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ920H1
PRIDEiQ920H1

PTM databases

PhosphoSitePlusiQ920H1

Expressioni

Tissue specificityi

Highly expressed in lung where it localizes to epithelial cells of the trachea, bronchus and bronchioles (at protein level) (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:25242865). Expressed in club/Clara cells of the bronchioles (PubMed:12406855). Also detected in the anterior and posterior lobes of the pituitary gland where it may localize to gonadotropic cells (at protein level) (PubMed:24514953). Not detected in other tissues tested (PubMed:11682631, PubMed:12175512).5 Publications

Developmental stagei

Detected in the pituitary gland from postnatal day 1 onwards (at protein level) (PubMed:24514953). Weakly expressed in embryonic lung at stages E11.5 and E12.5 (PubMed:11682631, PubMed:18535256). Seems to localize most strongly to the growing tips of bronchi at stage E13.5 (PubMed:18535256). Highly expressed in developing lung at stages E16.5 and E18.5, where it localizes to airway epithelia (PubMed:11682631, PubMed:12406855, PubMed:12175512, PubMed:24514953). During gestation, detected in the mammary gland at 6.5 days post coitum (dpc), but expression declines at 8.5 dpc and is absent at later stages (PubMed:12175512).5 Publications

Gene expression databases

BgeeiENSMUSG00000038791 Expressed in 38 organ(s), highest expression level in right lung lobe
CleanExiMM_SCGB3A2
GenevisibleiQ920H1 MM

Interactioni

Subunit structurei

Homodimer; disulfide-linked (PubMed:11682631, PubMed:24213919). Monomer (PubMed:11682631, PubMed:24213919). Interacts with APOA1 (By similarity).By similarity2 Publications

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000038872

Structurei

3D structure databases

SMRiQ920H1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the secretoglobin family. UGRP subfamily.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J1Y3 Eukaryota
ENOG4111402 LUCA
GeneTreeiENSGT00420000029848
HOGENOMiHOG000128185
HOVERGENiHBG079305
InParanoidiQ920H1
OMAiICSYSAT
OrthoDBiEOG091G10V3
PhylomeDBiQ920H1
TreeFamiTF336928

Family and domain databases

InterProiView protein in InterPro
IPR016126 Secretoglobin
PfamiView protein in Pfam
PF01099 Uteroglobin, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A1 Publication (identifier: Q920H1-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLVSIFLLV TIGICGYSAT ALLINRLPVV DKLPVPLDDI IPSFDPLKML
60 70 80 90
LKTLGISVEH LVTGLKKCVD ELGPEASEAV KKLLEALSHL V
Note: Major isoform.1 Publication
Length:91
Mass (Da):9,819
Last modified:October 25, 2017 - v2
Checksum:i2B5C4D39E6A4EE14
GO
Isoform B1 Publication (identifier: Q920H1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-84: L → LVIIICSYFPGRSLCYVNNLPSF

Show »
Length:113
Mass (Da):12,307
Checksum:iC25213F9BCB96F16
GO
Isoform C1 Publication (identifier: Q920H1-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-91: EALSHLV → VIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Show »
Length:139
Mass (Da):15,432
Checksum:i8A2FB080B41E65E4
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05918284L → LVIIICSYFPGRSLCYVNNL PSF in isoform B. 1 Publication1
Alternative sequenceiVSP_05918385 – 91EALSHLV → VIIICSYFPGRSLCYVNNLP SFVSVLFLPMICAYPRDSKK QTFAFIERVFEQSKL in isoform C. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274959 mRNA Translation: AAL25708.1
AF274960 mRNA Translation: AAL25709.1
AF274961 mRNA Translation: AAL25710.1
AF439546 mRNA Translation: AAQ04561.1
AK136373 mRNA Translation: BAE22952.1
AK136396 mRNA Translation: BAE22961.1
CH466528 Genomic DNA Translation: EDL10011.1
BC061046 mRNA Translation: AAH61046.1
CCDSiCCDS79640.1 [Q920H1-2]
CCDS79641.1 [Q920H1-3]
RefSeqiNP_001276572.1, NM_001289643.1 [Q920H1-3]
NP_001276573.1, NM_001289644.1 [Q920H1-2]
XP_011245113.1, XM_011246811.1 [Q920H1-1]
UniGeneiMm.210437

Genome annotation databases

EnsembliENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791 [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791 [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791 [Q920H1-3]
GeneIDi117158
KEGGimmu:117158
UCSCiuc008eum.2 mouse [Q920H1-2]
uc008eun.2 mouse
uc012bck.2 mouse [Q920H1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274959 mRNA Translation: AAL25708.1
AF274960 mRNA Translation: AAL25709.1
AF274961 mRNA Translation: AAL25710.1
AF439546 mRNA Translation: AAQ04561.1
AK136373 mRNA Translation: BAE22952.1
AK136396 mRNA Translation: BAE22961.1
CH466528 Genomic DNA Translation: EDL10011.1
BC061046 mRNA Translation: AAH61046.1
CCDSiCCDS79640.1 [Q920H1-2]
CCDS79641.1 [Q920H1-3]
RefSeqiNP_001276572.1, NM_001289643.1 [Q920H1-3]
NP_001276573.1, NM_001289644.1 [Q920H1-2]
XP_011245113.1, XM_011246811.1 [Q920H1-1]
UniGeneiMm.210437

3D structure databases

SMRiQ920H1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000038872

PTM databases

PhosphoSitePlusiQ920H1

Proteomic databases

PaxDbiQ920H1
PRIDEiQ920H1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043803; ENSMUSP00000038872; ENSMUSG00000038791 [Q920H1-1]
ENSMUST00000187157; ENSMUSP00000140476; ENSMUSG00000038791 [Q920H1-2]
ENSMUST00000189750; ENSMUSP00000140375; ENSMUSG00000038791 [Q920H1-3]
GeneIDi117158
KEGGimmu:117158
UCSCiuc008eum.2 mouse [Q920H1-2]
uc008eun.2 mouse
uc012bck.2 mouse [Q920H1-3]

Organism-specific databases

CTDi117156
MGIiMGI:2153470 Scgb3a2

Phylogenomic databases

eggNOGiENOG410J1Y3 Eukaryota
ENOG4111402 LUCA
GeneTreeiENSGT00420000029848
HOGENOMiHOG000128185
HOVERGENiHBG079305
InParanoidiQ920H1
OMAiICSYSAT
OrthoDBiEOG091G10V3
PhylomeDBiQ920H1
TreeFamiTF336928

Enzyme and pathway databases

ReactomeiR-MMU-3000480 Scavenging by Class A Receptors

Miscellaneous databases

PROiPR:Q920H1
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038791 Expressed in 38 organ(s), highest expression level in right lung lobe
CleanExiMM_SCGB3A2
GenevisibleiQ920H1 MM

Family and domain databases

InterProiView protein in InterPro
IPR016126 Secretoglobin
PfamiView protein in Pfam
PF01099 Uteroglobin, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSG3A2_MOUSE
AccessioniPrimary (citable) accession number: Q920H1
Secondary accession number(s): Q5D060, Q920H2, Q920H3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: October 25, 2017
Last modified: November 7, 2018
This is version 114 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again