Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitoferrin-1

Gene

Slc25a37

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe2+, is then probably delivered to ferrochelatase to catalyze Fe2+ incorporation into protoprophyrin IX to make heme.1 Publication

GO - Molecular functioni

  • ferrous iron transmembrane transporter activity Source: Reactome
  • iron ion transmembrane transporter activity Source: UniProtKB

GO - Biological processi

  • iron import into the mitochondrion Source: UniProtKB
  • iron ion homeostasis Source: GO_Central
  • mitochondrial transport Source: GO_Central

Keywordsi

Biological processIon transport, Iron transport, Transport
LigandIron

Protein family/group databases

TCDBi2.A.29.5.5 the mitochondrial carrier (mc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Mitoferrin-1
Alternative name(s):
Mitochondrial iron transporter 1
Mitochondrial solute carrier protein
Solute carrier family 25 member 37
Gene namesi
Name:Slc25a37
Synonyms:Mfrn, Mscp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1914962 Slc25a37

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei45 – 64Helical; Name=1Sequence analysisAdd BLAST20
Transmembranei106 – 125Helical; Name=2Sequence analysisAdd BLAST20
Transmembranei143 – 162Helical; Name=3Sequence analysisAdd BLAST20
Transmembranei200 – 219Helical; Name=4Sequence analysisAdd BLAST20
Transmembranei234 – 253Helical; Name=5Sequence analysisAdd BLAST20
Transmembranei301 – 320Helical; Name=6Sequence analysisAdd BLAST20

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002352521 – 338Mitoferrin-1Add BLAST338

Proteomic databases

PaxDbiQ920G8
PRIDEiQ920G8

PTM databases

PhosphoSitePlusiQ920G8

Expressioni

Tissue specificityi

Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen.2 Publications

Developmental stagei

In the developing embryo, it is first detected at embryonic day 7.5 (E7.5) in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in E14.5 fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation.1 Publication

Gene expression databases

BgeeiENSMUSG00000034248
CleanExiMM_SLC25A37
ExpressionAtlasiQ920G8 baseline and differential
GenevisibleiQ920G8 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000039990

Structurei

3D structure databases

ProteinModelPortaliQ920G8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati43 – 131Solcar 1Add BLAST89
Repeati141 – 225Solcar 2Add BLAST85
Repeati232 – 326Solcar 3Add BLAST95

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0760 Eukaryota
ENOG410XNT2 LUCA
GeneTreeiENSGT00550000074721
HOGENOMiHOG000038810
HOVERGENiHBG079464
InParanoidiQ920G8
KOiK15113
OMAiYFLTKHK
OrthoDBiEOG091G0PU8
PhylomeDBiQ920G8
TreeFamiTF314118

Family and domain databases

Gene3Di1.50.40.10, 2 hits
InterProiView protein in InterPro
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q920G8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELRRGGVGN QAAGRRMDGD CRDGGCGSKD AGSEDYENLP TSASVSTHMT
60 70 80 90 100
AGAMAGILEH SIMYPVDSVK TRMQSLNPDP KARYTSIYGA LKRIMHTEGF
110 120 130 140 150
WRPLRGLNVM MMGAGPAHAM YFACYENMKR TLNDVFSHQG NSHLANGVAG
160 170 180 190 200
SMATLLHDAV MNPAEVVKQR LQMYNSQHQS AFSCIRTVWR TEGLGAFYRS
210 220 230 240 250
YTTQLTMNIP FQSIHFITYE FLQEQVNPRR DYNPQSHIIS GGLAGALAAA
260 270 280 290 300
ATTPLDVCKT LLNTQENMAL SLANVSGRLS GMANAFRTVY QLNGLAGYFK
310 320 330
GIQARVIYQM PSTAISWSVY EFFKYILTKR QLENRTLY
Length:338
Mass (Da):37,510
Last modified:December 1, 2001 - v1
Checksum:iBB35B1F70C56A3FE
GO
Isoform 2 (identifier: Q920G8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-182: VAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAF → ILKAFVWSWEALLSGASSPGPSNLHPRQTENSRVT
     183-338: Missing.

Show »
Length:182
Mass (Da):19,838
Checksum:i18E2C5E801228693
GO
Isoform 3 (identifier: Q920G8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-112: TRMQSLNPDP...PLRGLNVMMM → GHCSASLNLK...AQLVVGTEVL
     113-338: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):11,616
Checksum:iD001C82BEE13BBFB
GO
Isoform 4 (identifier: Q920G8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-81: TRMQSLNPDPK → MDYLSPEKRIY
     82-338: Missing.

Note: No experimental confirmation available.
Show »
Length:81
Mass (Da):8,673
Checksum:i658FB174AEEA27FB
GO
Isoform 5 (identifier: Q920G8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-108: TRMQSLNPDP...GFWRPLRGLN → GHCSASLNLK...SLPNAQDIGK
     109-338: Missing.

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,219
Checksum:iF5491966426FFD83
GO

Sequence cautioni

The sequence BAB29978 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC25649 differs from that shown. Reason: Frameshift at positions 141 and 196.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti115G → R in BAC25649 (PubMed:16141072).Curated1
Sequence conflicti138H → P in BAC25649 (PubMed:16141072).Curated1
Sequence conflicti141N → T in BAC25649 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01840571 – 112TRMQS…NVMMM → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQLVVGTE VL in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_01840671 – 108TRMQS…LRGLN → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQDIGK in isoform 5. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_01840771 – 81TRMQSLNPDPK → MDYLSPEKRIY in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_01840882 – 338Missing in isoform 4. 1 PublicationAdd BLAST257
Alternative sequenceiVSP_018409109 – 338Missing in isoform 5. 1 PublicationAdd BLAST230
Alternative sequenceiVSP_018410113 – 338Missing in isoform 3. 1 PublicationAdd BLAST226
Alternative sequenceiVSP_018411148 – 182VAGSM…HQSAF → ILKAFVWSWEALLSGASSPG PSNLHPRQTENSRVT in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_018412183 – 338Missing in isoform 2. 2 PublicationsAdd BLAST156

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288621 mRNA Translation: AAL23859.1
AF361699 mRNA Translation: AAL27990.1
AK015790 mRNA Translation: BAB29978.1 Different initiation.
AK019700 mRNA Translation: BAB31839.2
AK021203 mRNA Translation: BAC25649.1 Frameshift.
AK050414 mRNA Translation: BAC34243.1
AK086749 mRNA Translation: BAC39735.1
CCDSiCCDS27238.1 [Q920G8-1]
RefSeqiNP_080607.2, NM_026331.3 [Q920G8-1]
UniGeneiMm.291443
Mm.293635
Mm.441111
Mm.489765

Genome annotation databases

EnsembliENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248 [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954 [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954 [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248 [Q920G8-2]
GeneIDi67712
KEGGimmu:67712
UCSCiuc029sla.1 mouse [Q920G8-1]
uc029sll.1 mouse [Q920G8-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMFRN1_MOUSE
AccessioniPrimary (citable) accession number: Q920G8
Secondary accession number(s): Q8C367
, Q8CEJ7, Q91ZY0, Q9D2G3, Q9D547
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: July 18, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health