Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (16 Oct 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mitoferrin-1

Gene

Slc25a37

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe2+, is then probably delivered to ferrochelatase to catalyze Fe2+ incorporation into protoprophyrin IX to make heme.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Iron transport, Transport
LigandIron

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.29.5.5 the mitochondrial carrier (mc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mitoferrin-1
Alternative name(s):
Mitochondrial iron transporter 1
Mitochondrial solute carrier protein
Solute carrier family 25 member 37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc25a37
Synonyms:Mfrn, Mscp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1914962 Slc25a37

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei45 – 64Helical; Name=1Sequence analysisAdd BLAST20
Transmembranei106 – 125Helical; Name=2Sequence analysisAdd BLAST20
Transmembranei143 – 162Helical; Name=3Sequence analysisAdd BLAST20
Transmembranei200 – 219Helical; Name=4Sequence analysisAdd BLAST20
Transmembranei234 – 253Helical; Name=5Sequence analysisAdd BLAST20
Transmembranei301 – 320Helical; Name=6Sequence analysisAdd BLAST20

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002352521 – 338Mitoferrin-1Add BLAST338

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q920G8

PRoteomics IDEntifications database

More...
PRIDEi
Q920G8

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q920G8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In the developing embryo, it is first detected at 7.5 dpc in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in 14.5 dpc fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000034248 Expressed in 266 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q920G8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q920G8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000039990

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q920G8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati43 – 131Solcar 1Add BLAST89
Repeati141 – 225Solcar 2Add BLAST85
Repeati232 – 326Solcar 3Add BLAST95

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0760 Eukaryota
ENOG410XNT2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158607
ENSGT00940000172945

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000038810

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q920G8

KEGG Orthology (KO)

More...
KOi
K15113

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQAVHFI

Database of Orthologous Groups

More...
OrthoDBi
1056670at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q920G8

TreeFam database of animal gene trees

More...
TreeFami
TF314118

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.50.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00153 Mito_carr, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103506 SSF103506, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50920 SOLCAR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q920G8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELRRGGVGN QAAGRRMDGD CRDGGCGSKD AGSEDYENLP TSASVSTHMT
60 70 80 90 100
AGAMAGILEH SIMYPVDSVK TRMQSLNPDP KARYTSIYGA LKRIMHTEGF
110 120 130 140 150
WRPLRGLNVM MMGAGPAHAM YFACYENMKR TLNDVFSHQG NSHLANGVAG
160 170 180 190 200
SMATLLHDAV MNPAEVVKQR LQMYNSQHQS AFSCIRTVWR TEGLGAFYRS
210 220 230 240 250
YTTQLTMNIP FQSIHFITYE FLQEQVNPRR DYNPQSHIIS GGLAGALAAA
260 270 280 290 300
ATTPLDVCKT LLNTQENMAL SLANVSGRLS GMANAFRTVY QLNGLAGYFK
310 320 330
GIQARVIYQM PSTAISWSVY EFFKYILTKR QLENRTLY
Length:338
Mass (Da):37,510
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBB35B1F70C56A3FE
GO
Isoform 2 (identifier: Q920G8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-182: VAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAF → ILKAFVWSWEALLSGASSPGPSNLHPRQTENSRVT
     183-338: Missing.

Show »
Length:182
Mass (Da):19,838
Checksum:i18E2C5E801228693
GO
Isoform 3 (identifier: Q920G8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-112: TRMQSLNPDP...PLRGLNVMMM → GHCSASLNLK...AQLVVGTEVL
     113-338: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):11,616
Checksum:iD001C82BEE13BBFB
GO
Isoform 4 (identifier: Q920G8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-81: TRMQSLNPDPK → MDYLSPEKRIY
     82-338: Missing.

Note: No experimental confirmation available.
Show »
Length:81
Mass (Da):8,673
Checksum:i658FB174AEEA27FB
GO
Isoform 5 (identifier: Q920G8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-108: TRMQSLNPDP...GFWRPLRGLN → GHCSASLNLK...SLPNAQDIGK
     109-338: Missing.

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,219
Checksum:iF5491966426FFD83
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QPY4J3QPY4_MOUSE
Mitoferrin-1
Gm16867 Slc25a37
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXC4V9GXC4_MOUSE
Predicted gene, 16867
Gm16867
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB29978 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC25649 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti115G → R in BAC25649 (PubMed:16141072).Curated1
Sequence conflicti138H → P in BAC25649 (PubMed:16141072).Curated1
Sequence conflicti141N → T in BAC25649 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01840571 – 112TRMQS…NVMMM → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQLVVGTE VL in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_01840671 – 108TRMQS…LRGLN → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQDIGK in isoform 5. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_01840771 – 81TRMQSLNPDPK → MDYLSPEKRIY in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_01840882 – 338Missing in isoform 4. 1 PublicationAdd BLAST257
Alternative sequenceiVSP_018409109 – 338Missing in isoform 5. 1 PublicationAdd BLAST230
Alternative sequenceiVSP_018410113 – 338Missing in isoform 3. 1 PublicationAdd BLAST226
Alternative sequenceiVSP_018411148 – 182VAGSM…HQSAF → ILKAFVWSWEALLSGASSPG PSNLHPRQTENSRVT in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_018412183 – 338Missing in isoform 2. 2 PublicationsAdd BLAST156

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF288621 mRNA Translation: AAL23859.1
AF361699 mRNA Translation: AAL27990.1
AK015790 mRNA Translation: BAB29978.1 Different initiation.
AK019700 mRNA Translation: BAB31839.2
AK021203 mRNA Translation: BAC25649.1 Frameshift.
AK050414 mRNA Translation: BAC34243.1
AK086749 mRNA Translation: BAC39735.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27238.1 [Q920G8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_080607.2, NM_026331.3 [Q920G8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248 [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954 [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954 [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248 [Q920G8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
67712

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:67712

UCSC genome browser

More...
UCSCi
uc029sla.1 mouse [Q920G8-1]
uc029sll.1 mouse [Q920G8-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288621 mRNA Translation: AAL23859.1
AF361699 mRNA Translation: AAL27990.1
AK015790 mRNA Translation: BAB29978.1 Different initiation.
AK019700 mRNA Translation: BAB31839.2
AK021203 mRNA Translation: BAC25649.1 Frameshift.
AK050414 mRNA Translation: BAC34243.1
AK086749 mRNA Translation: BAC39735.1
CCDSiCCDS27238.1 [Q920G8-1]
RefSeqiNP_080607.2, NM_026331.3 [Q920G8-1]

3D structure databases

SMRiQ920G8
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000039990

Protein family/group databases

TCDBi2.A.29.5.5 the mitochondrial carrier (mc) family

PTM databases

PhosphoSitePlusiQ920G8

Proteomic databases

PaxDbiQ920G8
PRIDEiQ920G8

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
67712

Genome annotation databases

EnsembliENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248 [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954 [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954 [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954 [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248 [Q920G8-2]
GeneIDi67712
KEGGimmu:67712
UCSCiuc029sla.1 mouse [Q920G8-1]
uc029sll.1 mouse [Q920G8-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51312
MGIiMGI:1914962 Slc25a37

Phylogenomic databases

eggNOGiKOG0760 Eukaryota
ENOG410XNT2 LUCA
GeneTreeiENSGT00940000158607
ENSGT00940000172945
HOGENOMiHOG000038810
InParanoidiQ920G8
KOiK15113
OMAiFQAVHFI
OrthoDBi1056670at2759
PhylomeDBiQ920G8
TreeFamiTF314118

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc25a37 mouse

Protein Ontology

More...
PROi
PR:Q920G8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000034248 Expressed in 266 organ(s), highest expression level in blood
ExpressionAtlasiQ920G8 baseline and differential
GenevisibleiQ920G8 MM

Family and domain databases

Gene3Di1.50.40.10, 2 hits
InterProiView protein in InterPro
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMFRN1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q920G8
Secondary accession number(s): Q8C367
, Q8CEJ7, Q91ZY0, Q9D2G3, Q9D547
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: October 16, 2019
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again