Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (12 Aug 2020)
Sequence version 2 (03 Sep 2014)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dystonin

Gene

Dst

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. Mediates docking of the dynein/dynactin motor complex to vesicle cargos for retrograde axonal transport through its interaction with TMEM108 and DCTN1.1 Publication
plays a structural role in the assembly of hemidesmosomes of epithelial cells; anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. Required for the regulation of keratinocyte polarity and motility; mediates integrin ITGB4 regulation of RAC1 activity.
required for bundling actin filaments around the nucleus.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi7032 – 70431PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi7068 – 70792PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Muscle protein
Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2022090, Assembly of collagen fibrils and other multimeric structures
R-MMU-446107, Type I hemidesmosome assembly

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dystonin
Alternative name(s):
Bullous pemphigoid antigen 1
Short name:
BPA
Dystonia musculorum protein
Hemidesmosomal plaque protein
Microtubule actin cross-linking factor 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dst
Synonyms:Bpag1, Macf2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:104627, Dst

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Endoplasmic reticulum, Intermediate filament, Membrane, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice show progressive deterioration in motor function and sensory neurodegeneration. Exhibit axonal swellings packed with disorganized intermediate filaments (IFs) and microtubules. Show poorly defined Z lines and display a reduction in sarcomere length. Have increased accumulation of vesicles and severely disrupted retrograde axonal transport. In stratified epithelia, hemidesmosomes are normal but they lack the inner plate and have no cytoskeleton attached.5 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1385R → A: Prevents isoform 6 from localizing to the nucleus; when associated with A-1386. 1 Publication1
Mutagenesisi1386R → A: Prevents isoform 6 from localizing to the nucleus; when associated with A-1385. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2176789

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000781411 – 7393DystoninAdd BLAST7393

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei236PhosphoserineCombined sources1
Modified residuei237PhosphoserineCombined sources1
Modified residuei1381PhosphoserineCombined sources1
Modified residuei2211PhosphoserineCombined sources1
Modified residuei2862PhosphoserineBy similarity1
Modified residuei3894PhosphoserineBy similarity1
Modified residuei4680PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki5401Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei5488PhosphoserineCombined sources1
Modified residuei7254PhosphoserineBy similarity1
Modified residuei7333PhosphoserineCombined sources1
Modified residuei7336PhosphoserineCombined sources1
Modified residuei7348PhosphoserineCombined sources1
Isoform 7 (identifier: Q91ZU6-8)
Modified residuei205PhosphoserineCombined sources1
Modified residuei208PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Lipoprotein, Myristate, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q91ZU6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q91ZU6

PeptideAtlas

More...
PeptideAtlasi
Q91ZU6

PRoteomics IDEntifications database

More...
PRIDEi
Q91ZU6

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00230689
IPI00230690
IPI00284272

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q91ZU6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q91ZU6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q91ZU6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and 2 are expressed in striated and heart muscle cells. Isoform 5 is expressed in the skin. Isoform 6 is expressed in sensory neural cells of the dorsal root ganglion and with low level in the skin (at protein level). Isoform 1 is expressed predominantly in the brain and spinal cord with low levels in the heart (PubMed:14581450). Isoform 2 is predominantly expressed in muscle and heart and with low levels in the brain. Isoform 5 is expressed in the skin and with low levels in myoblast cells. Isoform 6 is expressed in neurons. Isoform 7 is expressed in lung and with low levels in the brain.10 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 1 is the major form expressed in the dorsal root ganglia at 14.5 dpc. Isoform 2 is predominantly expressed in the myocardium, skeletal muscles, bone cartilage and epithelia of the tongue at 14.5 dpc. Isoform 5 is expressed at high levels in the epidermis and mucosal epithelia of the digestive tracts at 14.5 dpc.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000026131, Expressed in skin of back and 292 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q91ZU6, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with MAPRE1; probably required for targeting to the growing microtubule plus ends. Isoform 2 interacts (via N-terminus) with ACTN2. Isoform 2 interacts (via N-terminus) with PLEC (via N-terminus). Isoform 5 interacts (via N-terminus) with COL17A1 (via cytoplasmic region). Isoform 5 interacts (via N-terminus) with ITGB4 isoform beta-4a (via cytoplasmic region). Isoform 5 interacts (via N-terminus) with ERBIN (via C-terminus). Isoform 5 associates (via C-terminal) with KRT5-KRT14 (via rod region) intermediate filaments of keratins (By similarity). Isoform 2 and isoform 6 can homodimerize (via N-terminus). Isoform 2 interacts (via N-terminus) with PLEC (via N-terminus).

Interacts with the neuronal intermediate filament protein, PRPH.

Interacts with DES.

Interacts with SYNE3.

Isoform 1 interacts with TMEM108 (PubMed:17287360).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
199328, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q91ZU6, 9 interactors

Molecular INTeraction database

More...
MINTi
Q91ZU6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000095392

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q91ZU6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

17393
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q91ZU6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q91ZU6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 138Calponin-homology (CH) 1PROSITE-ProRule annotationCuratedAdd BLAST104
Domaini151 – 255Calponin-homology (CH) 2PROSITE-ProRule annotationCuratedAdd BLAST105
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati602 – 699Spectrin 1Add BLAST98
Repeati701 – 802Spectrin 2Add BLAST102
Domaini887 – 944SH3PROSITE-ProRule annotationAdd BLAST58
Repeati1292 – 1421Spectrin 3Add BLAST130
Repeati1439 – 1538Spectrin 4Add BLAST100
Repeati1584 – 1626Plectin 1Add BLAST43
Repeati1660 – 1703Plectin 2Add BLAST44
Repeati1774 – 1817Plectin 3Add BLAST44
Repeati1818 – 1855Plectin 4Add BLAST38
Repeati1856 – 1891Plectin 5Add BLAST36
Repeati3321 – 3427Spectrin 5Add BLAST107
Repeati3569 – 3678Spectrin 6Add BLAST110
Repeati3852 – 3971Spectrin 7Add BLAST120
Repeati3978 – 4084Spectrin 8Add BLAST107
Repeati4091 – 4190Spectrin 9Add BLAST100
Repeati4200 – 4299Spectrin 10Add BLAST100
Repeati4447 – 4552Spectrin 11Add BLAST106
Repeati4559 – 4663Spectrin 12Add BLAST105
Repeati4673 – 4773Spectrin 13Add BLAST101
Repeati4780 – 4882Spectrin 14Add BLAST103
Repeati4889 – 4989Spectrin 15Add BLAST101
Repeati4999 – 5098Spectrin 16Add BLAST100
Repeati5105 – 5208Spectrin 17Add BLAST104
Repeati5215 – 5319Spectrin 18Add BLAST105
Repeati5326 – 5428Spectrin 19Add BLAST103
Repeati5435 – 5537Spectrin 20Add BLAST103
Repeati5653 – 5755Spectrin 21Add BLAST103
Repeati5763 – 5863Spectrin 22Add BLAST101
Repeati5870 – 5976Spectrin 23Add BLAST107
Repeati5983 – 6085Spectrin 24Add BLAST103
Repeati6092 – 6195Spectrin 25Add BLAST104
Repeati6202 – 6304Spectrin 26Add BLAST103
Repeati6311 – 6413Spectrin 27Add BLAST103
Repeati6420 – 6522Spectrin 28Add BLAST103
Repeati6529 – 6632Spectrin 29Add BLAST104
Repeati6639 – 6740Spectrin 30Add BLAST102
Repeati6747 – 6849Spectrin 31Add BLAST103
Repeati6859 – 6989Spectrin 32Add BLAST131
Domaini7019 – 7054EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini7055 – 7090EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini7095 – 7173GARPROSITE-ProRule annotationAdd BLAST79

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni35 – 252Actin-bindingAdd BLAST218

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1382 – 1388Nuclear localization signal; in isoform 67
Motifi7373 – 7376Microtubule tip localization signal4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2367 – 2427Asp-richAdd BLAST61

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Its association with epidermal and simple keratins is dependent on the tertiary structure induced by heterodimerization of these intermediate filaments proteins and most likely involves recognition sites located in the rod domain of these keratins.
The microtubule tip localization signal (MtLS) motif; mediates interaction with MAPRE1 and targeting to the growing microtubule plus ends.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the plakin or cytolinker family.Curated

Keywords - Domaini

Coiled coil, Repeat, SH3 domain, Transmembrane

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0516, Eukaryota
KOG0517, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155008

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000015_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q91ZU6

KEGG Orthology (KO)

More...
KOi
K10382

Database of Orthologous Groups

More...
OrthoDBi
24858at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014, CH, 2 hits
cd00051, EFh, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 2 hits
3.30.920.20, 1 hit
3.90.1290.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR041615, Desmoplakin_SH3
IPR041573, Desmoplakin_Spectrin-like
IPR029926, Dystonin-like
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR003108, GAR_dom
IPR036534, GAR_dom_sf
IPR043197, Plakin
IPR035915, Plakin_repeat_sf
IPR001101, Plectin_repeat
IPR001452, SH3_domain
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat

The PANTHER Classification System

More...
PANTHERi
PTHR23169, PTHR23169, 1 hit
PTHR23169:SF24, PTHR23169:SF24, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307, CH, 2 hits
PF13499, EF-hand_7, 1 hit
PF02187, GAS2, 1 hit
PF00681, Plectin, 2 hits
PF17902, SH3_10, 1 hit
PF00435, Spectrin, 18 hits
PF18373, Spectrin_like, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033, CH, 2 hits
SM00054, EFh, 2 hits
SM00243, GAS2, 1 hit
SM00250, PLEC, 9 hits
SM00150, SPEC, 33 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF143575, SSF143575, 1 hit
SSF47473, SSF47473, 1 hit
SSF47576, SSF47576, 1 hit
SSF75399, SSF75399, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS00020, ACTININ_2, 1 hit
PS50021, CH, 2 hits
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 2 hits
PS51460, GAR, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 21 Publication (identifier: Q91ZU6-1) [UniParc]FASTAAdd to basket
Also known as: BPAG1-b, BPAG1a1, dystonin-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGYLSPAAY MYVEEQEYLQ AYEDVLERYK DERDKVQKKT FTKWINQHLM
60 70 80 90 100
KVRKHVNDLY EDLRDGHNLI SLLEVLSGDT LPREKGRMRF HRLQNVQIAL
110 120 130 140 150
DYLKRRQVKL VNIRNDDITD GNPKLTLGLI WTIILHFQIS DIHVTGESED
160 170 180 190 200
MSAKERLLLW TQQATEGYAG VRCENFTTCW RDGKLFNAII HKYRPDLIDM
210 220 230 240 250
NTVAVQSNLA NLEHAFYVAE KIGVIRLLDP EDVDVSSPDE KSVITYVSSL
260 270 280 290 300
YDAFPKVPEG GEGIGANDVE VKWIEYQNMV NYLIQWIRHH VVTMSERTFP
310 320 330 340 350
NNPLELKALY NQYLQFKEKE IPPKEMEKSK IKRLYKLLEI WIEFGRIKLL
360 370 380 390 400
QGYHPNDIEK EWGKLIIAML EREKALRPEV ERLDMLQQIA TRVQRDSVSC
410 420 430 440 450
EDKLILARNA LQSDSKRLES GVQFQNEAEI AGYILECENL LRQHVIDVQI
460 470 480 490 500
LIDGKYYQAD QLVQRVAKLR DEIMALRNEC SSVYSKGRML TTEQTKLMIS
510 520 530 540 550
GITQSLNSGF AQTLHPSLNS GLTQSLTPSL TSSSVTSGLS SGMTSRLTPS
560 570 580 590 600
VTPVYAPGFP SVVAPNFSLG VEPNSLQTLK LMQIRKPLLK SSLLDQNLTE
610 620 630 640 650
EEVNMKFVQD LLNWVDEMQV QLDRTEWGSD LPSVESHLEN HKNVHRAIEE
660 670 680 690 700
FESSLKEAKI SEIQMTAPLK LSYTDKLHRL ESQYAKLLNT SRNQERHLDT
710 720 730 740 750
LHNFVTRATN ELIWLNEKEE SEVAYDWSER NSSVARKKSY HAELMRELEQ
760 770 780 790 800
KEESIKAVQE IAEQLLLENH PARLTIEAYR AAMQTQWSWI LQLCQCVEQH
810 820 830 840 850
IQENSAYFEF FNDAKEATDY LRNLKDAIQR KYSCDRSSSI HKLEDLVQES
860 870 880 890 900
MEKEELLQYR SVVAGLMGRA KTVVQLKPRN PDNPLKTSIP IKAICDYRQI
910 920 930 940 950
EITIYKDDEC VLANNSHRAK WKVISPTGNE AMVPSVCFTV PPPNKEAVDF
960 970 980 990 1000
ANRIEQQYQS VLTLWHESHI NMKSVVSWHY LVNEIDRIRA SNVASIKTML
1010 1020 1030 1040 1050
PGEHQQVLSN LQSRLEDFLE DSQESQIFSG SDISQLEKEV SVCRKYYQEL
1060 1070 1080 1090 1100
LKSAEREEQE ESVYNLYISE VRNIRLRLES CEDRLIRQIR TPLERDDLHE
1110 1120 1130 1140 1150
SMLRITEQEK LKKELDRLKD DLGTITNKCE EFFSQAADSP SVPALRSELS
1160 1170 1180 1190 1200
VVIQSLSQIY SMSSTYIEKL KTVNLVLKNT QAAEALVKLY ETKLCEEEAV
1210 1220 1230 1240 1250
IADKNNIENL MSTLKQWRSE VDEKREVFHA LEDELQKAKA ISDEMFKTHK
1260 1270 1280 1290 1300
ERDLDFDWHK EKADQLVERW QSVHVQIDNR LRDLEGIGKS LKHYRDSYHP
1310 1320 1330 1340 1350
LDDWIQHIET TQRKIQENQP ENSKALALQL NQQKMLVSEI EVKQSKMDEC
1360 1370 1380 1390 1400
QKYSEQYSAA VKDYELQTMT YRAMVESQQK SPVKRRRIQS SADLVIQEFM
1410 1420 1430 1440 1450
DLRTRYTALV TLMTQYIKFA GDSLKRLEEE EKSLDEEKKQ HIEKAKELQK
1460 1470 1480 1490 1500
WVSNISKTLG DGEKAGKPLF SKQQMSSKEI STKKEQFSEA LQTTQIFLAK
1510 1520 1530 1540 1550
HGDKLTEEER SDLEKQVKTL QEGYNLLFSE SLKQQELQPS GESKVPEKPD
1560 1570 1580 1590 1600
KVIAGTINQT TGEVLSVFQA VLRGLIDYET GIRLLEAQLV ITGLISPELR
1610 1620 1630 1640 1650
KCFDLRDAES HGLIDEQVLR QLKELNRAKQ LISTASPTSI PVLDSLAQGM
1660 1670 1680 1690 1700
VSESMAIRVL EILLSAGPLL VPATGEHLTL QQAFQQNLIS SALFSKVLER
1710 1720 1730 1740 1750
QDTCKDLIDP CTSEKVSLTD MVQRSILQEN TRMWLLPVRP QEAGRITLKC
1760 1770 1780 1790 1800
GRSVSILRAA HEGLIDRETM FRLLGAQLLS GGLIDCNSGQ KMTVEEAVAE
1810 1820 1830 1840 1850
GVIDRDTASS ILTYQVQTGG IVHSNPAKRL TVDEAVQCEL ITSSSALLVL
1860 1870 1880 1890 1900
EAQRGYVGLI WPHSGEIFPT SSSLQQELIT NELASKILNG RQKIAALYIP
1910 1920 1930 1940 1950
ESSQVIGLDA AKQLGIIDNN TASVLKSVTL PDKMPDLGDL EDCKNAKRWL
1960 1970 1980 1990 2000
SFCKLQPSTV HDYRQEEGGS DGEEPVTAQS SEQTKKLFLS YLMVNSYMDA
2010 2020 2030 2040 2050
HTGQRLLLYD GDLDEAVGML LESCGTELGA DTSTRESLSV LTIPDAFPDC
2060 2070 2080 2090 2100
ALSEEKHECS AAAAGPDKCH YSHPGHKESL ENAKWDMNEA FCKMGNNDSN
2110 2120 2130 2140 2150
GELPRPENLA DTTVVQKGSE SPSRVRVPKP TSSSTQPEGS VLRPESGSIL
2160 2170 2180 2190 2200
KGCKSQSEPV TKKYPDGANH SHFLTSETSR PCDSNEREDE ENIQKGPSVF
2210 2220 2230 2240 2250
DYSPRLSALL SHDELRQSQG RFSDTSTPQN TGYLCEASTL SPSDQRVLAD
2260 2270 2280 2290 2300
QSTREKFQDQ FLGIAAISVS LQGAPCGQKP VDTECSSSQV HYHSEESMSD
2310 2320 2330 2340 2350
ASAESGATRQ TDESEKTGSK VEDNSCTMVP GGGSRNDNTS DCGPLSHKGA
2360 2370 2380 2390 2400
IDAGDYETSL LAGQQSDTAT DSDSDDYFYD TPLFEDEDHD SLILQGDDRD
2410 2420 2430 2440 2450
CLQPEDYDTS LQEENDRTPP PDDIFYDVMK EKENPEFPHG GMDESLGVEN
2460 2470 2480 2490 2500
KVCCPQGFPV GIEKPELYLA GEKEFNSGGS EQLVESVSES ENPPGLWDSE
2510 2520 2530 2540 2550
SDSLTEGEII GRKERLGASL TPDGHWRGDR EECDTSRESQ SDTDGVGSIQ
2560 2570 2580 2590 2600
SSESYRPYMS DGSDLDEEDN GGRSSEDSGD GRGGQGVADE GGEPQYQADP
2610 2620 2630 2640 2650
TQLYTAIRKE HGGETQNVSD MIPLDKTHSY SPLETQHGAG VFQPESAGRG
2660 2670 2680 2690 2700
GWDTERSSHP ELTTEADEED EASLSTHMAT KGVSLSNAEG TASEEIRLVQ
2710 2720 2730 2740 2750
GPDSTGILKA EDLENVSPEI SPSSDNIVRS EAELGGGASE DGHLSFTGSD
2760 2770 2780 2790 2800
RDQQGPGRGL VKGRDGQSDK LVDETSIREM GFQKEGVLMS SPEEGGEEER
2810 2820 2830 2840 2850
DLEPFPNGSA TESLNMGKSQ VPPLLTHTEE LSHRGAPHTT TMTTTMTLEG
2860 2870 2880 2890 2900
EAKNVQTGLT ESPVLLETLA EIFDTPASKV TRADLTSAVT ASEMKSQVKE
2910 2920 2930 2940 2950
DSLTGGPEKE TGPCTSLGHC DKCIHVDMLE PNEHTPSCAL VAPPTVKDNL
2960 2970 2980 2990 3000
CSVNNAGEKS VRPQEDWPPA AEVRLSDACV EESISEGKAG ILQFTPENSD
3010 3020 3030 3040 3050
STLSRLPHQS VAGWGKSADS VQARLPVSGV RHTSADTLDV GCPQLESSRE
3060 3070 3080 3090 3100
KASAEEEPHR ERALSLKPQE REHHMLGFVE DGRSILKSSL DKVHMNLQEV
3110 3120 3130 3140 3150
GDPSAGTGTK ISIQNLIRRA ILSELPNEVS NVPSHGISPI SNSSEVRAES
3160 3170 3180 3190 3200
GGDPFCITSF LHLLKQNQPP QETPGISELA KVLTQMDCDP EQRGLGSELL
3210 3220 3230 3240 3250
PPQLKNAFYK LLFDGYATEK DQAEALGQTS CAVPKMAEEK PHVCSDLRNK
3260 3270 3280 3290 3300
EGHHCPLNPQ AVGEAEVEPF SVHIAALPGG EKLGELCSEP PEHSESTSGS
3310 3320 3330 3340 3350
KERSSDSSSK EKCSNGLQQC LQHTEKMHEY LVLLQDMKPP LDNQASVESS
3360 3370 3380 3390 3400
LEALKSQLKQ LEAFELGLAP IAVFLRKDLK LAEEFLKSFP SDLPRRHHEE
3410 3420 3430 3440 3450
LSKSHQRLQN AFSSLSSVSS ERMKLIKLAI NSEMSKLAVR HEDFLHKLTS
3460 3470 3480 3490 3500
YSDWVSEKSR SVKAIQTVNV QDTELVKNSV KFLKNVLADL SHTKMQLETT
3510 3520 3530 3540 3550
AFDVQSFISD YAQDLSPSQS RQLLRLLNTT QKGFLDLQEL VTTEADRLEA
3560 3570 3580 3590 3600
LLQLEQELGH QKVVAERQQE YREKLQGLCD LLTQTENRLI SNQEAFVIGD
3610 3620 3630 3640 3650
GTVELQKYQS KQEELQRDMQ GSTQAMEEIV RNTELFLKES GDELSQADRA
3660 3670 3680 3690 3700
LIEQKLNEVK MKCAQLNLKA EQSRKELDKA VTTALKEETE KVAAVRQLEE
3710 3720 3730 3740 3750
SKTKIENLLN WLSNVEEDSE GVWTKHTQPM EQNGTYLHEG DSKLGAGEED
3760 3770 3780 3790 3800
EVNGNLLETD AEGHSEATKG NLNQQYEKVK AQHGKIMAQH QAVLLATQSA
3810 3820 3830 3840 3850
QVLLEKQGHY LSPEEKEKLQ KNTQELKVHY EKVLAECEKK VKLTHSLQEE
3860 3870 3880 3890 3900
LEKFDTDYSE FEHWLQQSEQ ELANLEAGAD DLSGLMDKLT RQKSFSEDVI
3910 3920 3930 3940 3950
SHKGDLRYIT ISGNRVIDAA KSCSKRDSDR IGKDSVETSA THREVQTKLD
3960 3970 3980 3990 4000
QVTDRFRSLY SKCSVLGNNL KDLVDQYQQY EDASCGLLSG LQACEAKASK
4010 4020 4030 4040 4050
HLREPIALDP KNLQRQLEET KALQGQISSQ QVAVEKLKKT AEVLLDAKGS
4060 4070 4080 4090 4100
LLPAKNDIQK TLDDIVGRYD DLSKCVNERN EKLQITLTRS LSVQDALDEM
4110 4120 4130 4140 4150
LDWMGSVESS LVKPGQVPLN STALQDLISK DTMLEQDITG RQSSINAMNE
4160 4170 4180 4190 4200
KVKTFIETTD PSTASSLQAK MKDLSARFSE ASQKHKEKLA KMVELKAKVE
4210 4220 4230 4240 4250
QFEKLSDKLQ TFLETQSQAL TEVAMPGKDV PELSQHMQES TAKFLEHRKD
4260 4270 4280 4290 4300
LEALHSLLKE ISSHGLPGDK ALVFEKTNNL SRKFKEMEDT IQEKKDALSS
4310 4320 4330 4340 4350
CQEQLSAFQT LAQSLKTWIK ETTKQVPVVK PSLGTEDLRK SLEETKKLQE
4360 4370 4380 4390 4400
KWNLKAPEIH KANNSGVSLC NLLSALISPA KAIAAAKSGG VILNGEGTDT
4410 4420 4430 4440 4450
NTQDFLANKG LTSIKKDMTD ISHSYEDLGL LLKDKIVELN TKLSKLQKAQ
4460 4470 4480 4490 4500
EESSAMMQWL EKMNKTASRW RQTPTPADTE SVKLQVEQNK SFEAELKQNV
4510 4520 4530 4540 4550
NKVQELKDKL SELLEENPEA PEAQSWKQAL AEMDTKWQEL NQLTMDRQQK
4560 4570 4580 4590 4600
LEESSNNLTQ FQTTEAQLKQ WLMEKELMVS VLGPLSIDPN MLNTQKQQVQ
4610 4620 4630 4640 4650
ILLQEFDTRK PQYEQLTAAG QGILSRPGED PSLHGIVNEQ LEAVTQKWDN
4660 4670 4680 4690 4700
LTGQLRDRCD WIDQAIVKST QYQSLLRSLS GTLTELDDKL SSGLTSGALP
4710 4720 4730 4740 4750
DAVNQQLEAA QRLKQEIEQQ APKIKEAQEV CEDLSALVKE EYLKAELSRQ
4760 4770 4780 4790 4800
LEGILKSFKD IEQKTENHVQ HLQSACASSH QFQQMSKDFQ AWLDAKKEEQ
4810 4820 4830 4840 4850
RDSPPISAKL DVLESLLNSQ KDFGKTFTEQ SNIYEKTISE GENLLLKTQG
4860 4870 4880 4890 4900
AEKAALQLQL NTMKTDWDRF RKQVKEREEK LKDSLEKALK YREQVETLRP
4910 4920 4930 4940 4950
WIDRCQHSLD GVTFSLDPTE SESSIAELKS LQKEMDHHFG MLELLNNTAN
4960 4970 4980 4990 5000
SLLSVCEVDK EAVTEENQSL MEKVNRVTEQ LQSKTVSLEN MAQKFKEFQE
5010 5020 5030 5040 5050
VSRDTQRQLQ DTKEQLEVHH SLGPQAYSNK HLSVLQAQQK SLQTLKQQVD
5060 5070 5080 5090 5100
EAKRLAQDLV VEAADSKGTS DVLLQAETLA EEHSELSQQV DEKCSFLETK
5110 5120 5130 5140 5150
LQGLGHFQNT IREMFSQFTE CDDELDGMAP VGRDAETLRK QKACMQTFLK
5160 5170 5180 5190 5200
KLEALMASND SANRTCKMML ATEETSPDLI GVKRDLEALS KQCNKLLDRA
5210 5220 5230 5240 5250
KTREEQVDGA TEKLEEFHRK LEEFSTLLQK AEEHEESQGP VGTETETINQ
5260 5270 5280 5290 5300
QLDVFKVFQK EEIEPLQVKQ QDVNWLGQGL IQSAAANTCT QGLEHDLDSV
5310 5320 5330 5340 5350
NSRWKTLNKK VAQRTSQLQE ALLHCGRFQD ALESLLSWMA DTEELVANQK
5360 5370 5380 5390 5400
PPSAEFKVVK AQIQEQKLLQ RLLEDRKSTV EVIKREGEKI AASAEPADRV
5410 5420 5430 5440 5450
KLTRQLSLLD SRWEALLSRA EARNRQLEGI SVVAQEFHET LEPLNEWLTA
5460 5470 5480 5490 5500
VEKKLANSEP IGTQAPKLEE QISQHKALQE DILLRKQSVD QALLNGLELL
5510 5520 5530 5540 5550
KQTTGDEVLI IQDKLEAIKA RYKDITKLSA DVAKTLEHAL QLAGQLQSMH
5560 5570 5580 5590 5600
KELCNWLDKV EVELLSYETQ GLKGEAASQV QERQKELKNE VRSNKALVDS
5610 5620 5630 5640 5650
LNEVSSALLE LVPWRAREGL EKTIAEDNER YRLVSDTITQ KVEEIDAAIL
5660 5670 5680 5690 5700
RSQQFEQAAD AELSWITETQ KKLMSLGDIR LEQDQTSAQL QVQKAFTMDI
5710 5720 5730 5740 5750
LRHKDIIDEL VTSGHKIMTT SSEEEKQSMK KKLDKVLKKY DAVCQINSER
5760 5770 5780 5790 5800
HLQLERAQSL VSQFWETYEE LWPWLTETQR IISQLPAPAL EYETLRRQQE
5810 5820 5830 5840 5850
EHRQLRELIA EHKPHIDKMN KTGPQLLELS PKEGIYIQEK YVAADTLYSQ
5860 5870 5880 5890 5900
IKEDVKKRAV VLDEAISQST QFHDKIDQIL ESLERIAERL RQPPSISAEV
5910 5920 5930 5940 5950
EKIKEQIGEN KSVSVDMEKL QPLYETLRQR GEEMIARSEG TEKDVSARAV
5960 5970 5980 5990 6000
QDKLDQMVFI WGSIHTLVEE REAKLLDVME LAEKFWCDHM SLVVTIKDTQ
6010 6020 6030 6040 6050
DFIRDLEDPG IDPSVVKQQQ EAAEAIREEI DGLQEELDMV ITLGSELIAA
6060 6070 6080 6090 6100
CGEPDKPIVK KSIDELNSAW DSLNKAWKDR VDRLEEAMQA AVQYQDGLQG
6110 6120 6130 6140 6150
IFDWVDIAGN KLATMSPIGT DLETVKQQIE ELKQFKSEAY QQQIEMERLN
6160 6170 6180 6190 6200
HQAELLLKKV TEEADKHTVQ DPLMELKLIW DSLDERIVSR QHKLEGALLA
6210 6220 6230 6240 6250
LGQFQHALDE LLAWLTHTKG LLSEQKPVGG DPKAIEIELA KHHVLQNDVL
6260 6270 6280 6290 6300
AHQSTVEAVN KAGNDLIESS EGEEASNLQY KLRILNQRWQ DILEKTDQRK
6310 6320 6330 6340 6350
QQLDSALRQA KGFHGEIEDL QQWLTDTERH LLASKPLGGL PETAKEQLNA
6360 6370 6380 6390 6400
HMEVCTAFAI KEETYKSLML RGQQMLARCP RSAETNIDQD ITNLKEKWES
6410 6420 6430 6440 6450
VKSKLNEKKT KLEEALHLAM NFHNSLQDFI NWLTQAEQTL NVASRPSLIL
6460 6470 6480 6490 6500
DTILFQIDEH KVFANEVNSH REQIIELDKT GTHLKYFSQK QDVVLIKNLL
6510 6520 6530 6540 6550
ISVQSRWEKV VQRLVERGRS LDEARKRAKQ FHEAWSKLME WLEESEKSLD
6560 6570 6580 6590 6600
SELEIANDPD KIKAQLVQHK EFQKSLGGKH SVYDTTNRTG RSLKEKTSLA
6610 6620 6630 6640 6650
DDNLKLDNML SELRDKWDTI CGKSVERQNK LEEALLFSGQ FTDALQALID
6660 6670 6680 6690 6700
WLYRVEPQLA EDQPVHGDID LVMNLIDNHK VFQKELGKRT SSVQALKRSA
6710 6720 6730 6740 6750
RELIEGSRDD SSWVRVQMQE LSTRWETVCA LSISKQTRLE SALQQAEEFH
6760 6770 6780 6790 6800
SVVHTLLEWL AEAEQTLRFH GALPDDEDAL RTLIEQHKEF MKRLEEKRAE
6810 6820 6830 6840 6850
LSKATGMGDA LLAVCHPDSI TTIKHWITII QARFEEVLAW AKQHQQRLAG
6860 6870 6880 6890 6900
ALAGLIAKQE LLETLLAWLQ WAETTLTEKD KEVIPQEIEE VKTLIAEHQT
6910 6920 6930 6940 6950
FMEEMTRKQP DVDKVTKTYK RRATDPPSLQ SHIPVLDKGR AGRKRFPASG
6960 6970 6980 6990 7000
FYPSGSQTQI ETKNPRVNLL VSKWQQVWLL ALERRRKLND ALDRLEELRE
7010 7020 7030 7040 7050
FANFDFDIWR KKYMRWMNHK KSRVMDFFRR IDKDQDGKIT RQEFIDGILS
7060 7070 7080 7090 7100
SKFPTSRLEM SAVADIFDRD GDGYIDYYEF VAALHPNKDA YKPITDADKI
7110 7120 7130 7140 7150
EDEVTRQVAK CKCAKRFQVE QIGDNKYRFF LGNQFGDSQQ LRLVRILRST
7160 7170 7180 7190 7200
VMVRVGGGWM ALDEFLVKND PCRVHHHGSK MLRSESNSSI TATQPTLAKG
7210 7220 7230 7240 7250
RTNMELREKF ILADGASQGM AAFRPRGRRS RPSSRGASPN RSTSASSHAC
7260 7270 7280 7290 7300
QAASPPVPAA ASTPKGTPIQ GSKLRLPGYL SGKGFHSGED SALITTAAAR
7310 7320 7330 7340 7350
VRTQFAESRK TPSRPGSRAG SKAGSRASSR RGSDASDFDI SEIQSVCSDV
7360 7370 7380 7390
ETVPQTHRPV PRAGSRPSTA KPSKIPTPQR RSPASKLDKS SKR
Length:7,393
Mass (Da):834,218
Last modified:September 3, 2014 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC3CDF88978C33EF1
GO
Isoform 11 Publication (identifier: Q91ZU6-2) [UniParc]FASTAAdd to basket
Also known as: BPAG1-a1 Publication, BPAG1a2, BPAG1n41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1549-3562: Missing.

Show »
Length:5,379
Mass (Da):615,214
Checksum:i083579C45EA0566F
GO
Isoform 3Curated (identifier: Q91ZU6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7129-7134: Missing.
     7174-7197: Missing.
     7265-7265: K → KILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAE

Show »
Length:7,400
Mass (Da):834,953
Checksum:i80B5A7C7FDA19949
GO
Isoform 4Curated (identifier: Q91ZU6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7174-7197: Missing.
     7265-7265: K → KILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAE

Show »
Length:7,406
Mass (Da):835,660
Checksum:iFA78FB01B169CFA7
GO
Isoform 5 (identifier: Q91ZU6-5) [UniParc]FASTAAdd to basket
Also known as: BPAG1-e

The sequence of this isoform differs from the canonical sequence as follows:
     1-381: MAGYLSPAAY...REKALRPEVE → MQSSSYSYRS...SFSNESLDGH
     1432-1432: K → MKRSKENSEH...GISNLYYSSQ
     1433-7393: Missing.

Show »
Length:2,639
Mass (Da):304,781
Checksum:i1FB46C15C1834D29
GO
Isoform 6 (identifier: Q91ZU6-6) [UniParc]FASTAAdd to basket
Also known as: BPAG1n, BPAG1-n1, BPAG1-n2, BPAG1a2, dystonin-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MAGYLSPAAYMYVEEQEYLQAYEDVLERYK → MIAAAFLVLL...PAERAVLRIA
     305-7393: Missing.

Note: Incomplete sequence. Transmembrane protein (helical transmembrane domain from amino acid 18 to 38).Curated
Show »
Length:482
Mass (Da):55,058
Checksum:iA40496BA1F6125BD
GO
Isoform 7 (identifier: Q91ZU6-8) [UniParc]FASTAAdd to basket
Also known as: BPAG1a3

The sequence of this isoform differs from the canonical sequence as follows:
     1-137: MAGYLSPAAY...GLIWTIILHF → MGNVCGCVRA...SKDAPRDDGC
     271-272: VK → KG
     273-7393: Missing.

Note: Incomplete sequence. Probably myristoylated on Gly-2. Probably S-palmitoylated on Cys-5 and Cys-7. Mutagenesis of Gly-2 to Ala inhibits cortical localization. Mutagenesis of Cys-5 to Ser inhibits cortical localization. Mutagenesis of Cys-7 to Ser inhibits cortical localization.Curated
Show »
Length:388
Mass (Da):42,618
Checksum:i7258EC5F1E2DA4E7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R1P5S4R1P5_MOUSE
Dystonin
Dst
7,717Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q9X1E9Q9X1_MOUSE
Dystonin
Dst
7,406Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WSP0A0A087WSP0_MOUSE
Dystonin
Dst
5,175Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R1Y6S4R1Y6_MOUSE
Dystonin
Dst
1,638Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WPR7A0A087WPR7_MOUSE
Dystonin
Dst
2,987Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WRB8A0A087WRB8_MOUSE
Dystonin
Dst
1,471Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2A8S4R2A8_MOUSE
Dystonin
Dst
262Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2C6S4R2C6_MOUSE
Dystonin
Dst
259Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLZ3A0A1D5RLZ3_MOUSE
Dystonin
Dst
1,674Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BGG5A0A571BGG5_MOUSE
Dystonin
Dst
386Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC52231 differs from that shown. Reason: Frameshift.Curated
The sequence AAK83382 differs from that shown. Many conflicts and frameshifts that might be strain-specific.Curated
The sequence AAK83383 differs from that shown. Many conflicts and frameshifts that might be strain-specific.Curated
The sequence AAK83384 differs from that shown. Many conflicts and frameshifts that might be strain-specific.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 6 (identifier: Q91ZU6-6)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti101E → K in AAC52231 (PubMed:7670468).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0554591 – 381MAGYL…RPEVE → MQSSSYSYRSSDSVFSNTTS TRTSLDSNENLLSVHCGPTL INSCISFSNESLDGH in isoform 5. 1 PublicationAdd BLAST381
Alternative sequenceiVSP_0415421 – 137MAGYL…IILHF → MGNVCGCVRAEKEEPYFDPA KSPLSPEKYSPGRKYFRRKP CQKVVDDTEPVRQSSEREGK KGVSQPAGGQPAVSSGELPW EDPAASPTKEDAVQLGKRAA TEHGDQKPLPSSVDGYPHRV TVSSAQGRYSEVQVSIPDKI ISEEDSPPYCPETERHLDDV NSKHRTFLRKDNVSLSQTAA SSSPILCVTEKSLKNSALMG NLSRSCHSVLEQDSDERGHP FGVHRLQLTKRRCHSLSSGV SCVSKDAPRDDGC in isoform 7. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_0415431 – 30MAGYL…LERYK → MIAAAFLVLLRPYSIQCALF LLLLLLGTVATIVFFCCWHR KLQKGRHPMKSVFSGRSRSR DAALRSHHFRSEGFRASPRH IRRRVAAAAAARLEEVKPVV EVHHQSEQESSGRKRRIKKN SRVQPEFYHSVQGASTRRPS SGNASYRCSMSSSADFSDED DFSQKSGSASPAPGDTLPWN LPKHERSKRKIQGGSVLDPA ERAVLRIA in isoform 6. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_041544271 – 272VK → KG in isoform 7. 1 Publication2
Alternative sequenceiVSP_041545273 – 7393Missing in isoform 7. 1 PublicationAdd BLAST7121
Alternative sequenceiVSP_041546305 – 7393Missing in isoform 6. 1 PublicationAdd BLAST7089
Alternative sequenceiVSP_0554601432K → MKRSKENSEHGAYSDLLQRQ RATMVENSKLTGKISELETM VAELKKQKSRVEEELPKVKE AAENELRKQQRNVEDIALQK LRAESEAKQYRRELETIVRE KEAAERELERVRQLTAEAEA RRAAVEENLRNFRSQLQENT FTRQTLEDHLRRKDSSLSDL EQQKRALVEELQRKRDHEEE LLRLVKQMERDLAFQKQVAE KQLKEKQKVELEARRKITEI QFSCRESAAVAQARPQREQG RQKEEELKQQVDELTLANRK AEKEMRELKYELSAVQLEKA SSEEKARLLKDKLDETNNTL KCLKEDLERKDQAQERYSQQ LRDLGRQLNQTTDKAEEVRQ EANDLKKIKHTYQLELESLH QEKGKLQREVDRVTRAHALA ERNIQCLNSQVHASRDEKDL SEERRRLCQRKSDHLKEEFE RSHAQLLQNIQAEKENNDKI QKLNKELEKSNECAETLKQK VDELTRQNNETKLMMQRIQA ESKNIVREKQAIQQRCEVLR IQADGFKDQLRNTNEHLHKQ TKTEQDFHRKIKSLEDDLAQ SQNLVSEFKQKCDQQSMIIQ KTEKEVRSLSAELSASKEEK RREEQKAQLQRAQVQELNDR LKRVQDELHLKTIEEQMTHR KMILLQEESDKFKRSADEFR KKMEKLMESKVVTETDLSGI KHDFVSLQRENFRAQENAKL WETNIRELERQLQCYREKMQ QGPPVEANHYQKCRRLEEEL LAQRREVENLKQKMDQQIKE HEHQLLRLQCEIQKKSTTQD HTFASAFDTAGRECHHPAEI SPGNSGHLNLKTRLPLSRWT QEPHQTEGKWPHRAAEQLPK EVQFRQPGAPLDRESSQPCY SEYFSQTSTELQITFDDKNP ITRLSELETMREQALHPSRP PVTYQDDKLERELVKLLTPL EIAKNKQCGMHTEVTTLKQE KRLGSSAGGWMLEGCRTSGG LKGDFLKKSVEPEASPSLDL NQACSVRDEEFQFQGLRHTV TGRQLVEAKLLDMRTVEQLR LGLKTVEEVQRSLSKFLTKA TSIAGLYLESSKEKMSFTSA AQKIIIDKMIALAFLEAQAA TGFIIDPVSGQTYCVEDAVL HGIVDPEFRSRLLEAEKAVL GYSHASKTLSVFQAMENRML DRKKGKHILEAQIASGGVID PVRGVRVPPEMAVQQGLLNN AVLQFLHEPSSNTRVFPNPN NKQALYYSELLQICVFDVDC QCFLLPFGEREISNLNIEKT HKIAVVDTKTGAELTAFEAF QRNLIDKGIYLELSGQQYQW KEATFFDSYGHPSHMLTDTK TGLQFNISEAVEQGTLDKAL VQKYQEGLTTLTELADFLLS KVVPKKDLHSPIAGYWLTAS GERISLLKASRRNLVDRVTA LRCLEAQICTGGIIDPLTGK KYRVAEALHRGLVDEGFAQQ LRQCELVITGISHPVSNKMM SVVEAVNANIISKEMGMRCL EFQYLTGGLIEPKVFSRLTI EEALHVGIIDVLIATRLKDQ KSYVRDIMCPQTKRKLTYKE ALEKADFDFHTGLKLLEVSE PLGTGISNLYYSSQ in isoform 5. 1 Publication1
Alternative sequenceiVSP_0554611433 – 7393Missing in isoform 5. 1 PublicationAdd BLAST5961
Alternative sequenceiVSP_0415491549 – 3562Missing in isoform 1. 1 PublicationAdd BLAST2014
Alternative sequenceiVSP_0415507129 – 7134Missing in isoform 3. 1 Publication6
Alternative sequenceiVSP_0415517174 – 7197Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0415527265K → KILHPLTRNYGKPWLANSKM STPCKAAECPDFPVSSAE in isoform 3 and isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF396877 mRNA Translation: AAK83382.1 Sequence problems.
AF396878 mRNA Translation: AAK83383.1 Sequence problems.
AF396879 mRNA Translation: AAK83384.1 Sequence problems.
AC123072 Genomic DNA No translation available.
AC124386 Genomic DNA No translation available.
AC127433 Genomic DNA No translation available.
U22452 mRNA Translation: AAC52230.1
U25158 mRNA Translation: AAC52231.1 Frameshift.
DQ023311 mRNA Translation: AAY46942.1
DQ463750 mRNA Translation: ABF00406.1
AK051626 mRNA Translation: BAC34695.1
AK037206 mRNA Translation: BAC29753.1
AF115383 mRNA Translation: AAD22959.1
AB085694 mRNA Translation: BAB93448.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35534.1 [Q91ZU6-1]
CCDS35535.1 [Q91ZU6-2]
CCDS69875.1 [Q91ZU6-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A60776
I49290
I49298

NCBI Reference Sequences

More...
RefSeqi
NP_034211.2, NM_010081.2 [Q91ZU6-5]
NP_598594.2, NM_133833.3 [Q91ZU6-2]
NP_604443.2, NM_134448.3 [Q91ZU6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000097785; ENSMUSP00000095392; ENSMUSG00000026131 [Q91ZU6-1]
ENSMUST00000097786; ENSMUSP00000095393; ENSMUSG00000026131 [Q91ZU6-2]
ENSMUST00000183302; ENSMUSP00000138376; ENSMUSG00000026131 [Q91ZU6-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
13518

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:13518

UCSC genome browser

More...
UCSCi
uc007aoi.2, mouse [Q91ZU6-1]
uc007aoj.2, mouse [Q91ZU6-2]
uc007aok.1, mouse [Q91ZU6-8]
uc007aol.2, mouse [Q91ZU6-5]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF396877 mRNA Translation: AAK83382.1 Sequence problems.
AF396878 mRNA Translation: AAK83383.1 Sequence problems.
AF396879 mRNA Translation: AAK83384.1 Sequence problems.
AC123072 Genomic DNA No translation available.
AC124386 Genomic DNA No translation available.
AC127433 Genomic DNA No translation available.
U22452 mRNA Translation: AAC52230.1
U25158 mRNA Translation: AAC52231.1 Frameshift.
DQ023311 mRNA Translation: AAY46942.1
DQ463750 mRNA Translation: ABF00406.1
AK051626 mRNA Translation: BAC34695.1
AK037206 mRNA Translation: BAC29753.1
AF115383 mRNA Translation: AAD22959.1
AB085694 mRNA Translation: BAB93448.1
CCDSiCCDS35534.1 [Q91ZU6-1]
CCDS35535.1 [Q91ZU6-2]
CCDS69875.1 [Q91ZU6-5]
PIRiA60776
I49290
I49298
RefSeqiNP_034211.2, NM_010081.2 [Q91ZU6-5]
NP_598594.2, NM_133833.3 [Q91ZU6-2]
NP_604443.2, NM_134448.3 [Q91ZU6-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2IAKX-ray3.00A580-803[»]
SMRiQ91ZU6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi199328, 15 interactors
IntActiQ91ZU6, 9 interactors
MINTiQ91ZU6
STRINGi10090.ENSMUSP00000095392

Chemistry databases

ChEMBLiCHEMBL2176789

PTM databases

iPTMnetiQ91ZU6
PhosphoSitePlusiQ91ZU6
SwissPalmiQ91ZU6

2D gel databases

REPRODUCTION-2DPAGEiIPI00230689
IPI00230690
IPI00284272

Proteomic databases

jPOSTiQ91ZU6
PaxDbiQ91ZU6
PeptideAtlasiQ91ZU6
PRIDEiQ91ZU6

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31066, 173 antibodies

Genome annotation databases

EnsembliENSMUST00000097785; ENSMUSP00000095392; ENSMUSG00000026131 [Q91ZU6-1]
ENSMUST00000097786; ENSMUSP00000095393; ENSMUSG00000026131 [Q91ZU6-2]
ENSMUST00000183302; ENSMUSP00000138376; ENSMUSG00000026131 [Q91ZU6-5]
GeneIDi13518
KEGGimmu:13518
UCSCiuc007aoi.2, mouse [Q91ZU6-1]
uc007aoj.2, mouse [Q91ZU6-2]
uc007aok.1, mouse [Q91ZU6-8]
uc007aol.2, mouse [Q91ZU6-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
667
MGIiMGI:104627, Dst

Phylogenomic databases

eggNOGiKOG0516, Eukaryota
KOG0517, Eukaryota
GeneTreeiENSGT00940000155008
HOGENOMiCLU_000015_1_0_1
InParanoidiQ91ZU6
KOiK10382
OrthoDBi24858at2759

Enzyme and pathway databases

ReactomeiR-MMU-2022090, Assembly of collagen fibrils and other multimeric structures
R-MMU-446107, Type I hemidesmosome assembly

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
13518, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dst, mouse
EvolutionaryTraceiQ91ZU6

Protein Ontology

More...
PROi
PR:Q91ZU6
RNActiQ91ZU6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000026131, Expressed in skin of back and 292 other tissues
GenevisibleiQ91ZU6, MM

Family and domain databases

CDDicd00014, CH, 2 hits
cd00051, EFh, 1 hit
Gene3Di1.10.418.10, 2 hits
3.30.920.20, 1 hit
3.90.1290.10, 3 hits
InterProiView protein in InterPro
IPR001589, Actinin_actin-bd_CS
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR041615, Desmoplakin_SH3
IPR041573, Desmoplakin_Spectrin-like
IPR029926, Dystonin-like
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR003108, GAR_dom
IPR036534, GAR_dom_sf
IPR043197, Plakin
IPR035915, Plakin_repeat_sf
IPR001101, Plectin_repeat
IPR001452, SH3_domain
IPR018159, Spectrin/alpha-actinin
IPR002017, Spectrin_repeat
PANTHERiPTHR23169, PTHR23169, 1 hit
PTHR23169:SF24, PTHR23169:SF24, 1 hit
PfamiView protein in Pfam
PF00307, CH, 2 hits
PF13499, EF-hand_7, 1 hit
PF02187, GAS2, 1 hit
PF00681, Plectin, 2 hits
PF17902, SH3_10, 1 hit
PF00435, Spectrin, 18 hits
PF18373, Spectrin_like, 1 hit
SMARTiView protein in SMART
SM00033, CH, 2 hits
SM00054, EFh, 2 hits
SM00243, GAS2, 1 hit
SM00250, PLEC, 9 hits
SM00150, SPEC, 33 hits
SUPFAMiSSF143575, SSF143575, 1 hit
SSF47473, SSF47473, 1 hit
SSF47576, SSF47576, 1 hit
SSF75399, SSF75399, 2 hits
PROSITEiView protein in PROSITE
PS00019, ACTININ_1, 1 hit
PS00020, ACTININ_2, 1 hit
PS50021, CH, 2 hits
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 2 hits
PS51460, GAR, 1 hit
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYST_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q91ZU6
Secondary accession number(s): E9PXE5
, E9QL23, Q1KP04, Q3I6J6, Q60824, Q60845, Q8K5D4, Q91ZU7, Q91ZU8, Q9WU50, S4R1U5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 30, 2003
Last sequence update: September 3, 2014
Last modified: August 12, 2020
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again