Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q91ZS8 (RED1_MOUSE)

Entry version 129 (08 May 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Double-stranded RNA-specific editase 1

Gene

Adarb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2 and GRIK2) and serotonin (HTR2C), GABA receptor (GABRA3) and potassium voltage-gated channel (KCNA1). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alter their functional activities. Edits GRIA2 at both the Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. Can inhibit cell proliferation and migration and can stimulate exocytosis.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

1D-myo-inositol hexakisphosphateBy similarityNote: Binds 1 myo-inositol hexakisphosphate (IP6) per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi394ZincPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei396Proton donorPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei400Inositol hexakisphosphateBy similarity1
Binding sitei401Inositol hexakisphosphateBy similarity1
Metal bindingi451ZincPROSITE-ProRule annotation1
Metal bindingi526ZincPROSITE-ProRule annotation1
Binding sitei529Inositol hexakisphosphateBy similarity1
Binding sitei532Inositol hexakisphosphateBy similarity1
Binding sitei639Inositol hexakisphosphateBy similarity1
Binding sitei672Inositol hexakisphosphateBy similarity1
Binding sitei682Inositol hexakisphosphateBy similarity1
Binding sitei700Inositol hexakisphosphateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, RNA-binding
Biological processmRNA processing
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-75102 C6 deamination of adenosine
R-MMU-77042 Formation of editosomes by ADAR proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double-stranded RNA-specific editase 1 (EC:3.5.4.37)
Alternative name(s):
RNA-editing deaminase 1
RNA-editing enzyme 1
dsRNA adenosine deaminase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Adarb1
Synonyms:Adar2, Red1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:891999 Adarb1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001717801 – 711Double-stranded RNA-specific editase 1Add BLAST711

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei149PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q91ZS8

PeptideAtlas

More...PeptideAtlasi		Q91ZS8

PRoteomics IDEntifications database

More...PRIDEi		Q91ZS8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q91ZS8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q91ZS8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000020262 Expressed in 242 organ(s), highest expression level in brain

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q91ZS8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q91ZS8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Homodimerization is essential for its catalytic activity. Can form heterodimers with isoform 5 of ADAR/ADAR1 (By similarity).By similarity

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q91ZS8, 1 interactor

Molecular INTeraction database

More...MINTi		Q91ZS8

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000095976

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1711
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L2KNMR-B231-301[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q91ZS8

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q91ZS8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini78 – 144DRBM 1PROSITE-ProRule annotationAdd BLAST67
Domaini231 – 298DRBM 2PROSITE-ProRule annotationAdd BLAST68
Domaini370 – 707A to I editasePROSITE-ProRule annotationAdd BLAST338

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni83 – 88Interaction with substrate RNABy similarity6
Regioni104 – 105Interaction with substrate RNABy similarity2
Regioni237 – 242Interaction with substrate RNABy similarity6
Regioni259Interaction with substrate RNABy similarity1

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2777 Eukaryota
ENOG410XT0Z LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155992

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q91ZS8

KEGG Orthology (KO)

More...KOi		K13194

Identification of Orthologs from Complete Genome Data

More...OMAi		LGEYPLP

Database of Orthologous Groups

More...OrthoDBi		947117at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q91ZS8

TreeFam database of animal gene trees

More...TreeFami		TF315806

Family and domain databases

Conserved Domains Database

More...CDDi		cd00048 DSRM, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50137 DS_RBD, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q91ZS8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDIEDEENMS SSSTDIKENR NLDNMPPKDS STPGPGEGIP LSNGGGGSTS 
        60         70         80         90        100
RKRPLEEGSN GHSKYRLKKR RKTPGPVLPK NALMQLNEIK PGLQYMLLSQ 
       110        120        130        140        150
TGPVHAPLFV MSVEVNGQVF EGSGPTKKKA KLHAAEKALR SFVQFPNASE 
       160        170        180        190        200
AHLAMGRTLS VNTDFTSDQA DFPDTLFNGF ETPDKSEPPF YVGSNGDDSF 
       210        220        230        240        250
SSSGDVSLSA SPVPASLTQP PLPIPPPFPP PSGKNPVMIL NELRPGLKYD 
       260        270        280        290        300
FLSESGESHA KSFVMSVVVD GQFFEGSGRN KKLAKARAAQ SALATVFNLH 
       310        320        330        340        350
LDQTPSRQPV LSEGLQLHLP QVLADAVSRL VLGKFSDLTD NFSSPHARRK 
       360        370        380        390        400
VLSGVVMTTG TDVKDAKVIS VSTGTKCING EYMSDRGLAL NDCHAEIISR 
       410        420        430        440        450
RSLLRFLYAQ LELYLNNKED QKKSIFQKSE RGGFRLKDTV QFHLYISTSP 
       460        470        480        490        500
CGDARIFSPH EPVLEGMTPD SHQLTEPADR HPNRKARGQL RTKIESGEGT 
       510        520        530        540        550
IPVRSNASIQ TWDGVLQGER LLTMSCSDKI ARWNVVGIQG SLLSIFVEPI 
       560        570        580        590        600
YFSSIILGSL YHGDHLSRAM YQRISNIEDL PPLYTLNKPL LSGISNAEAR 
       610        620        630        640        650
QPGKAPNFSV NWTVGDATIE VINATTGKDE LGRPSRLCKH ALYCRWMRVH 
       660        670        680        690        700
GKVPPHLLRT KITKPTTYHE SKLAAREYQA AKARLFTAFI KAGLGAWVEK 
       710 
PTEQDQFSFT P
Length:711
Mass (Da):78,001
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA5C87E894C867DE1
GO
Isoform 2 (identifier: Q91ZS8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     466-475: Missing.

Show »
Length:701
Mass (Da):76,932
Checksum:i9DC35AB940ECDC1B
GO
Isoform 3 (identifier: Q91ZS8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDIEDEENMS → MPLG
     466-475: Missing.

Show »
Length:695
Mass (Da):76,137
Checksum:iF88ED2F95BBC3A98
GO
Isoform 4 (identifier: Q91ZS8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: Missing.

Show »
Length:687
Mass (Da):75,232
Checksum:iAE6B8C4AAAD81726
GO
Isoform 5 (identifier: Q91ZS8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: Missing.
     466-475: Missing.

Show »
Length:677
Mass (Da):74,164
Checksum:iCB889950207BC99B
GO
Isoform 6 (identifier: Q91ZS8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASLGLGTLTVGAFFSFVGRRYKRRRKKRSERKDKRGLRQSRSPQKCFTM

Note: Likely expressed from an alternative promoter. Contains a region highly similar to the so-called ssRNA-binding R-domain of ADARB2.
Show »
Length:760
Mass (Da):83,732
Checksum:i0EDD0CC438EE2393
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RDS5D6RDS5_MOUSE
Double-stranded RNA-specific editas...
Adarb1
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGS1D6RGS1_MOUSE
Double-stranded RNA-specific editas...
Adarb1
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti65Y → C in AAK17102 (PubMed:12709013).Curated1
Sequence conflicti559S → G in AAK17102 (PubMed:12709013).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0137091 – 24Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0137101 – 10MDIEDEENMS → MPLG in isoform 3. 1 Publication10
Alternative sequenceiVSP_0414231M → MASLGLGTLTVGAFFSFVGR RYKRRRKKRSERKDKRGLRQ SRSPQKCFTM in isoform 6. 1 Publication1
Alternative sequenceiVSP_013711466 – 475Missing in isoform 2, isoform 3 and isoform 5. 2 Publications10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF403106 mRNA Translation: AAL01301.1
AF403107 mRNA Translation: AAL01302.1
AF403108 mRNA Translation: AAL01303.1
AF403109 mRNA Translation: AAL01304.1
AF525421 mRNA Translation: AAM83099.1
AY162454 mRNA Translation: AAN86546.1
AF291049 mRNA Translation: AAK17102.1
FJ169505 mRNA Translation: ACN49026.1
AK141777 mRNA Translation: BAE24831.1
AK147298 mRNA Translation: BAE27830.1
CH466553 Genomic DNA Translation: EDL31813.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS35948.1 [Q91ZS8-1]
CCDS35949.1 [Q91ZS8-2]

NCBI Reference Sequences

More...RefSeqi		NP_001020008.1, NM_001024837.2 [Q91ZS8-1]
NP_570965.2, NM_130895.3 [Q91ZS8-2]
XP_006513128.1, XM_006513065.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000020496; ENSMUSP00000020496; ENSMUSG00000020262 [Q91ZS8-2]
ENSMUST00000098374; ENSMUSP00000095976; ENSMUSG00000020262 [Q91ZS8-1]
ENSMUST00000105406; ENSMUSP00000101046; ENSMUSG00000020262 [Q91ZS8-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		110532

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:110532

UCSC genome browser

More...UCSCi		uc007fvl.2 mouse [Q91ZS8-3]
uc007fvm.2 mouse [Q91ZS8-1]
uc007fvn.2 mouse [Q91ZS8-5]
uc007fvp.2 mouse [Q91ZS8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF403106 mRNA Translation: AAL01301.1
AF403107 mRNA Translation: AAL01302.1
AF403108 mRNA Translation: AAL01303.1
AF403109 mRNA Translation: AAL01304.1
AF525421 mRNA Translation: AAM83099.1
AY162454 mRNA Translation: AAN86546.1
AF291049 mRNA Translation: AAK17102.1
FJ169505 mRNA Translation: ACN49026.1
AK141777 mRNA Translation: BAE24831.1
AK147298 mRNA Translation: BAE27830.1
CH466553 Genomic DNA Translation: EDL31813.1
CCDSiCCDS35948.1 [Q91ZS8-1]
CCDS35949.1 [Q91ZS8-2]
RefSeqiNP_001020008.1, NM_001024837.2 [Q91ZS8-1]
NP_570965.2, NM_130895.3 [Q91ZS8-2]
XP_006513128.1, XM_006513065.1

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L2KNMR-B231-301[»]
SMRiQ91ZS8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ91ZS8, 1 interactor
MINTiQ91ZS8
STRINGi10090.ENSMUSP00000095976

PTM databases

iPTMnetiQ91ZS8
PhosphoSitePlusiQ91ZS8

Proteomic databases

PaxDbiQ91ZS8
PeptideAtlasiQ91ZS8
PRIDEiQ91ZS8

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		110532
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000020496; ENSMUSP00000020496; ENSMUSG00000020262 [Q91ZS8-2]
ENSMUST00000098374; ENSMUSP00000095976; ENSMUSG00000020262 [Q91ZS8-1]
ENSMUST00000105406; ENSMUSP00000101046; ENSMUSG00000020262 [Q91ZS8-1]
GeneIDi110532
KEGGimmu:110532
UCSCiuc007fvl.2 mouse [Q91ZS8-3]
uc007fvm.2 mouse [Q91ZS8-1]
uc007fvn.2 mouse [Q91ZS8-5]
uc007fvp.2 mouse [Q91ZS8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		104
MGIiMGI:891999 Adarb1

Phylogenomic databases

eggNOGiKOG2777 Eukaryota
ENOG410XT0Z LUCA
GeneTreeiENSGT00940000155992
InParanoidiQ91ZS8
KOiK13194
OMAiLGEYPLP
OrthoDBi947117at2759
PhylomeDBiQ91ZS8
TreeFamiTF315806

Enzyme and pathway databases

ReactomeiR-MMU-75102 C6 deamination of adenosine
R-MMU-77042 Formation of editosomes by ADAR proteins

Miscellaneous databases

EvolutionaryTraceiQ91ZS8

Protein Ontology

More...PROi		PR:Q91ZS8

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000020262 Expressed in 242 organ(s), highest expression level in brain
ExpressionAtlasiQ91ZS8 baseline and differential
GenevisibleiQ91ZS8 MM

Family and domain databases

CDDicd00048 DSRM, 2 hits
InterProiView protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom
PfamiView protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 2 hits
SMARTiView protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 2 hits
PROSITEiView protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50137 DS_RBD, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRED1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q91ZS8
Secondary accession number(s): C3TTQ1
, Q3UHM7, Q8K3X1, Q91ZS6, Q91ZS7, Q91ZS9, Q99MU8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: May 8, 2019
This is version 129 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again