Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (29 Sep 2021)
Sequence version 2 (03 Oct 2012)
Previous versions | rss
Add a publicationFeedback
Protein

Disks large homolog 2

Gene

Dlg2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-438066, Unblocking of NMDA receptors, glutamate binding and activation
R-MMU-5673001, RAF/MAP kinase cascade
R-MMU-6794361, Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dlg2
Synonyms:Dlgh2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1344351, Dlg2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000052572

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945541 – 852Disks large homolog 2Add BLAST852

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi7S-palmitoyl cysteineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei28PhosphoserineCombined sources1
Modified residuei58PhosphotyrosineCombined sources1
Modified residuei65PhosphoserineCombined sources1
Modified residuei307PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei360PhosphoserineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei406PhosphoserineBy similarity1
Modified residuei414PhosphoserineCombined sources1
Modified residuei505PhosphotyrosineCombined sources1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei553PhosphoserineCombined sources1
Modified residuei732PhosphotyrosineCombined sources1
Modified residuei737PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q91XM9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q91XM9

PeptideAtlas

More...
PeptideAtlasi
Q91XM9

PRoteomics IDEntifications database

More...
PRIDEi
Q91XM9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
279675 [Q91XM9-1]
279676 [Q91XM9-2]
279677 [Q91XM9-3]
279678 [Q91XM9-4]
279679 [Q91XM9-5]
279680 [Q91XM9-6]
279681 [Q91XM9-7]
279682 [Q91XM9-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q91XM9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q91XM9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q91XM9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052572, Expressed in brain and 207 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q91XM9, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NOS1/nNOS through second PDZ domain.

Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (By similarity).

Interacts with KCNJ4 (PubMed:11997254).

Interacts with FRMPD4 (via C-terminus) (By similarity).

Interacts through its PDZ domains with NETO1 (PubMed:19243221).

Interacts with LRFN1, LRFN2 and LRFN4.

Interacts with FASLG (By similarity).

Interacts with KCNJ4 (By similarity).

Interacts with ADAM22 (PubMed:20089912).

Interacts with DGKI (via PDZ-binding motif) (By similarity).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
204763, 20 interactors

Database of interacting proteins

More...
DIPi
DIP-31569N

Protein interaction database and analysis system

More...
IntActi
Q91XM9, 19 interactors

Molecular INTeraction database

More...
MINTi
Q91XM9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000102814

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q91XM9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1852
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q91XM9

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q91XM9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini98 – 185PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini193 – 280PDZ 2PROSITE-ProRule annotationAdd BLAST88
Domaini421 – 502PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini662 – 837Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform 7 has an L27 domain close to N-terminus.

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155156

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001715_4_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q91XM9

Database of Orthologous Groups

More...
OrthoDBi
807583at2759

TreeFam database of animal gene trees

More...
TreeFami
TF323171

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12032, SH3_DLG2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313, DLG1-like
IPR019590, DLG1_PEST_dom
IPR035759, DLG2_SH3
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR019583, PDZ_assoc
IPR036034, PDZ_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF10608, MAGUK_N_PEST, 1 hit
PF00595, PDZ, 3 hits
PF10600, PDZ_assoc, 1 hit
PF00018, SH3_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741, MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072, GuKc, 1 hit
SM01277, MAGUK_N_PEST, 1 hit
SM00228, PDZ, 3 hits
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044, SSF50044, 1 hit
SSF50156, SSF50156, 3 hits
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 3 hits
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q91XM9-1) [UniParc]FASTAAdd to basket
Also known as: PSD93-alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLGEDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST
410 420 430 440 450
ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVTLDGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS
660 670 680 690 700
YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD
710 720 730 740 750
YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER
760 770 780 790 800
GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK
810 820 830 840 850
TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE

KL
Length:852
Mass (Da):94,880
Last modified:October 3, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i632914AE45ACEBB6
GO
Isoform 2 (identifier: Q91XM9-2) [UniParc]FASTAAdd to basket
Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

Show »
Length:859
Mass (Da):95,531
Checksum:iD3BE703AE529AC57
GO
Isoform 3 (identifier: Q91XM9-3) [UniParc]FASTAAdd to basket
Also known as: PSD93-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP

Show »
Length:791
Mass (Da):87,790
Checksum:i645487F4769B1768
GO
Isoform 4 (identifier: Q91XM9-4) [UniParc]FASTAAdd to basket
Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:887
Mass (Da):97,928
Checksum:i7416EAB77947D245
GO
Isoform 5 (identifier: Q91XM9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
     394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH
     395-852: Missing.

Show »
Length:491
Mass (Da):53,570
Checksum:i0926554D5F3A8FE6
GO
Isoform 6 (identifier: Q91XM9-6) [UniParc]FASTAAdd to basket
Also known as: PSD93 epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.
     43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE

Show »
Length:810
Mass (Da):90,071
Checksum:iE3F3ADB9E5ECA0D5
GO
Isoform 7 (identifier: Q91XM9-7) [UniParc]FASTAAdd to basket
Also known as: PSD93 zeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT
     69-86: Missing.

Show »
Length:976
Mass (Da):109,239
Checksum:i137F926A3694DC90
GO
Isoform 8 (identifier: Q91XM9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL

Note: Incomplete sequence.Curated
Show »
Length:852
Mass (Da):95,055
Checksum:iED0E8A1613E89FF5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A338P6J0A0A338P6J0_MOUSE
Disks large homolog 2
Dlg2
994Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YWU0D3YWU0_MOUSE
Disks large homolog 2
Dlg2
481Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BEZ4A0A571BEZ4_MOUSE
Disks large homolog 2
Dlg2
919Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YUZ8D3YUZ8_MOUSE
Disks large homolog 2
Dlg2
755Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q2L2E9Q2L2_MOUSE
Disks large homolog 2
Dlg2
870Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BEK3A0A571BEK3_MOUSE
Disks large homolog 2
Dlg2
901Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MQA2A0A5F8MQA2_MOUSE
Disks large homolog 2
Dlg2
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MPY4A0A5F8MPY4_MOUSE
Disks large homolog 2
Dlg2
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti107G → S in BAC32772 (PubMed:16141072).Curated1
Sequence conflicti123D → G in AAK64496 (Ref. 1) Curated1
Sequence conflicti213N → D in AAK64496 (Ref. 1) Curated1
Sequence conflicti301M → T in AAK64496 (Ref. 1) Curated1
Sequence conflicti323S → P in AAK64496 (Ref. 1) Curated1
Sequence conflicti585T → I in AAK64496 (Ref. 1) Curated1
Sequence conflicti776I → T in AAK64496 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0128691 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0155171 – 61Missing in isoform 3. CuratedAdd BLAST61
Alternative sequenceiVSP_0155181 – 42Missing in isoform 6. CuratedAdd BLAST42
Alternative sequenceiVSP_0155191 – 14MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7. CuratedAdd BLAST14
Alternative sequenceiVSP_0155201 – 13MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. CuratedAdd BLAST13
Alternative sequenceiVSP_01552143 – 67HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6. CuratedAdd BLAST25
Alternative sequenceiVSP_01552262 – 68SHISPLK → MQHAFIP in isoform 3. Curated7
Alternative sequenceiVSP_01552369 – 86Missing in isoform 7. CuratedAdd BLAST18
Alternative sequenceiVSP_012870394S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5. 1 Publication1
Alternative sequenceiVSP_012871395 – 852Missing in isoform 5. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_015524465 – 503DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF388675 mRNA Translation: AAK64496.1
AK046525 mRNA Translation: BAC32772.1
AK039754 mRNA Translation: BAC30440.1
AC100322 Genomic DNA No translation available.
AC101784 Genomic DNA No translation available.
AC108818 Genomic DNA No translation available.
AC108832 Genomic DNA No translation available.
AC109506 Genomic DNA No translation available.
AC112262 Genomic DNA No translation available.
AC118621 Genomic DNA No translation available.
AC119218 Genomic DNA No translation available.
AC121261 Genomic DNA No translation available.
AC122002 Genomic DNA No translation available.
AC127299 Genomic DNA No translation available.
AC127683 Genomic DNA No translation available.
AC140196 Genomic DNA No translation available.
AC141890 Genomic DNA No translation available.
AC161490 Genomic DNA No translation available.
AC162304 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40021.1 [Q91XM9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001229976.1, NM_001243047.1
NP_035937.2, NM_011807.3 [Q91XM9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572 [Q91XM9-1]
ENSMUST00000238619; ENSMUSP00000158731; ENSMUSG00000052572 [Q91XM9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23859

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:23859

UCSC genome browser

More...
UCSCi
uc009ihr.2, mouse [Q91XM9-1]
uc009ihs.1, mouse [Q91XM9-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388675 mRNA Translation: AAK64496.1
AK046525 mRNA Translation: BAC32772.1
AK039754 mRNA Translation: BAC30440.1
AC100322 Genomic DNA No translation available.
AC101784 Genomic DNA No translation available.
AC108818 Genomic DNA No translation available.
AC108832 Genomic DNA No translation available.
AC109506 Genomic DNA No translation available.
AC112262 Genomic DNA No translation available.
AC118621 Genomic DNA No translation available.
AC119218 Genomic DNA No translation available.
AC121261 Genomic DNA No translation available.
AC122002 Genomic DNA No translation available.
AC127299 Genomic DNA No translation available.
AC127683 Genomic DNA No translation available.
AC140196 Genomic DNA No translation available.
AC141890 Genomic DNA No translation available.
AC161490 Genomic DNA No translation available.
AC162304 Genomic DNA No translation available.
CCDSiCCDS40021.1 [Q91XM9-1]
RefSeqiNP_001229976.1, NM_001243047.1
NP_035937.2, NM_011807.3 [Q91XM9-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WL7X-ray2.03A95-188[»]
SMRiQ91XM9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi204763, 20 interactors
DIPiDIP-31569N
IntActiQ91XM9, 19 interactors
MINTiQ91XM9
STRINGi10090.ENSMUSP00000102814

PTM databases

iPTMnetiQ91XM9
PhosphoSitePlusiQ91XM9
SwissPalmiQ91XM9

Proteomic databases

jPOSTiQ91XM9
PaxDbiQ91XM9
PeptideAtlasiQ91XM9
PRIDEiQ91XM9
ProteomicsDBi279675 [Q91XM9-1]
279676 [Q91XM9-2]
279677 [Q91XM9-3]
279678 [Q91XM9-4]
279679 [Q91XM9-5]
279680 [Q91XM9-6]
279681 [Q91XM9-7]
279682 [Q91XM9-8]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q91XM9, 11 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
8247, 366 antibodies

The DNASU plasmid repository

More...
DNASUi
23859

Genome annotation databases

EnsembliENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572 [Q91XM9-1]
ENSMUST00000238619; ENSMUSP00000158731; ENSMUSG00000052572 [Q91XM9-4]
GeneIDi23859
KEGGimmu:23859
UCSCiuc009ihr.2, mouse [Q91XM9-1]
uc009ihs.1, mouse [Q91XM9-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1740
MGIiMGI:1344351, Dlg2
VEuPathDBiHostDB:ENSMUSG00000052572

Phylogenomic databases

eggNOGiKOG0708, Eukaryota
GeneTreeiENSGT00940000155156
HOGENOMiCLU_001715_4_2_1
InParanoidiQ91XM9
OrthoDBi807583at2759
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-MMU-438066, Unblocking of NMDA receptors, glutamate binding and activation
R-MMU-5673001, RAF/MAP kinase cascade
R-MMU-6794361, Neurexins and neuroligins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23859, 0 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dlg2, mouse
EvolutionaryTraceiQ91XM9

Protein Ontology

More...
PROi
PR:Q91XM9
RNActiQ91XM9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052572, Expressed in brain and 207 other tissues
GenevisibleiQ91XM9, MM

Family and domain databases

CDDicd12032, SH3_DLG2, 1 hit
Gene3Di2.30.42.10, 3 hits
InterProiView protein in InterPro
IPR016313, DLG1-like
IPR019590, DLG1_PEST_dom
IPR035759, DLG2_SH3
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR019583, PDZ_assoc
IPR036034, PDZ_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF10608, MAGUK_N_PEST, 1 hit
PF00595, PDZ, 3 hits
PF10600, PDZ_assoc, 1 hit
PF00018, SH3_1, 1 hit
PIRSFiPIRSF001741, MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SM01277, MAGUK_N_PEST, 1 hit
SM00228, PDZ, 3 hits
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF50156, SSF50156, 3 hits
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 3 hits
PS50002, SH3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q91XM9
Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: October 3, 2012
Last modified: September 29, 2021
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again