Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q91WS2 (NLRP6_MOUSE)

Entry version 160 (23 Feb 2022)
Sequence version 3 (21 Aug 2007)
Previous versions | rss
Add a publicationFeedback
Protein

NACHT, LRR and PYD domains-containing protein 6

Gene

Nlrp6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as the sensor component of the NLRP6 inflammasome, which mediates inflammasome activation in response to various pathogen-associated signals, leading to maturation and secretion of IL1B and IL18 (PubMed:21593405, PubMed:30392956, PubMed:32424362, PubMed:34678144).

Inflammasomes are supramolecular complexes that assemble in the cytosol in response to pathogens and other damage-associated signals and play critical roles in innate immunity and inflammation (PubMed:30392956).

Acts as a recognition receptor (PRR): recognizes and binds specific pathogens and other damage-associated signals, such as lipoteichoic acid (LTA), a cell-wall component of Gram-positive bacteria, or double stranded RNA (dsRNA) (PubMed:26494172, PubMed:30392956, PubMed:34678144).

May also recognize and bind lipopolysaccharide (LPS), a major component of the outer membrane of Gram-negative bacteria; however, LPS is probably not a major activator of the NLRP6 inflammasome (PubMed:34678144).

Following LTA- or dsRNA-binding, NLRP6 undergoes liquid-liquid phase separation (LLPS), enhancing multivalent interactions, an essential step for the formation of the NLRP6 inflammasome polymeric complex (PubMed:34678144).

The NLRP6 inflammasome acts by promoting recruitment of effector proinflammatory caspases (CASP1 and/or CASP4) that catalyze maturation and secretion of IL1B and IL18 in the extracellular milieu (PubMed:30392956).

The NLRP6 inflammasome plays a central role in the maintenance of epithelial integrity and host defense against microbial infections in the intestine (PubMed:21565393, PubMed:22763455, PubMed:23696660, PubMed:26638072, PubMed:28445725, PubMed:30392956).

Required to restrict infection against Gram-positive bacteria by recognizing lipoteichoic acid (LTA), leading to recruitment of CASP4 and CASP1, and subsequent maturation and secretion of IL1B and IL18 (PubMed:30392956).

Involved in intestinal antiviral innate immunity together with DHX15: recognizes and binds viral dsRNA to restrict infection by enteric viruses through the interferon pathway and GSDMD-dependent release of IL18 (PubMed:26494172, PubMed:34678144).

Required to prevent infection by the apicomplexan parasite C.tyzzeri in enterocytes by promoting GSDMD-dependent release of IL18 (PubMed:33372132).

The NLRP6 inflammasome may also regulate the gut microbiota composition by acting as a sensor of microbiota-associated metabolites to form a PYCARD/ASC-dependent inflammasome for downstream IL18 release and secretion of antimicrobial peptides (PubMed:21565393, PubMed:22763455, PubMed:26638072, PubMed:33617596).

Its role in the regulation of the gut microbiota composition is however subject to discussion (PubMed:29281815, PubMed:29281837, PubMed:28801232).

Essential for gut mucosal self-renewal and proliferation (PubMed:21593405, PubMed:21543645, PubMed:21565393).

Regulate mucus secretion in an inflammasome- and autophagy-dependent manner to prevent invasion by enteric bacteria (PubMed:24581500, PubMed:27339979).

During systemic bacterial infections, the NLRP6 inflammasome negatively regulates neutrophil recruitment and neutrophil extracellular traps (NETs) formation (PubMed:22763455, PubMed:30248149, PubMed:33918100, PubMed:33230225).

May promote peripheral nerve recovery following injury via an inflammasome-independent mechanism (PubMed:26253422).

22 Publications

Caution

The role of the NLRP6 inflammasome in the regulation of the gut microbiota composition is unclear (PubMed:21565393, PubMed:22763455, PubMed:26638072, PubMed:29281815, PubMed:29281837, PubMed:28801232). Some studies suggest that NLRP6 shapes the commensal gut microbiota composition (PubMed:21565393, PubMed:22763455, PubMed:26638072). However, other groups do not observe any difference in microbiota composition between wild-type and knockout mice (PubMed:29281815, PubMed:29281837, PubMed:28801232). Differences observed were attributed to mother and cage covariates rather than Nlrp6 deficiency (PubMed:29281815, PubMed:29281837, PubMed:28801232).6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi200 – 207ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity, Inflammatory response, Innate immunity
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 6Curated
Alternative name(s):
Angiotensin II/vasopressin receptor1 Publication
Non-angiotensin-vasopressin receptor1 Publication
Short name:
Non-AVR1 Publication
PYRIN-containing APAF1-like protein 5-like1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nlrp61 PublicationImported
Synonyms:Nalp61 Publication, Navr1 Publication, Pypaf51 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2141990, Nlrp6

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000038745

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Inflammasome, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Knockout mice are born at the expected Mendelian rate with no morphological abnormalities (PubMed:20923861, PubMed:21593405). They are characterized by spontaneous intestinal hyperplasia, inflammatory cell recruitment, exacerbation of chemical colitis induced by exposure to dextran sodium sulfate (DSS) and develop higher tumor loads in response to a combined treatment with the alkylating procarcinogen azoxymethane (AOM) and DSS (PubMed:21593405, PubMed:21543645, PubMed:21565393, PubMed:26638072). The colitogenic phenotype is associated with altered microbiota and is transmissible to cohoused wild-type mice, both early in postnatal life and during adulthood (PubMed:22763455, PubMed:21565393, PubMed:26638072). The effect on microbiota composition is however unclear, since a number of reports do not observe any difference in microbiota composition between wild-type and knockout mice (PubMed:29281815, PubMed:29281837, PubMed:28801232). Mice infected with an enteric pathogen, such as Citrobacter rodentium, show impaired clearance of the bacteria from colon (PubMed:24581500). Their intestinal epithelium lack a thick continuous overlaying inner mucus layer and exhibit a marked goblet cell hyperplasia along with abrogated mucus secretion (PubMed:24581500). When injected intraperitoneally or intravenously, knockout mice show increased resistance to Salmonella typhimurium, Listeria monocytogenes or Escherichia coli (PubMed:22763455). Mice show reduced intestinal antiviral innate immunity and are more susceptible to oral infection with encephalomyocarditis virus (PubMed:26494172). After crushing the sciatic nerve, mutant mice have a more dramatic drop in sciatic function index immediately upon surgery compared to the control group and need more time to recover fully (PubMed:26253422). Mutant animals show reduced systolic blood pressure without affecting heart rate (PubMed:20923861). Males, but not females, exhibit increased urine flow and decreased ability to reduce urinary flow under water restriction conditions compared to wild type littermates (PubMed:20923861). Mutant males may show somewhat lowered cognitive performance (PubMed:20923861).12 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi170 – 173RARR → AAAA: Does not affect formation of liquid-liquid phase separation (LLPS). 1 Publication4
Mutagenesisi350 – 354KDKKK → ADAAA: Impaired formation of liquid-liquid phase separation (LLPS), leading to reduced formation of the NLRP6 inflammasome and GSDMD-dependent release of IL18. 1 Publication5

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000808931 – 869NACHT, LRR and PYD domains-containing protein 6Add BLAST869

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated with 'Lys-63'-linked chains, promoting the interaction with PYCARD/ASC and formation of the NLRP6 inflammasome (PubMed:32424362). Deubiquitination by CYLD decreases the interaction with PYCARD/ASC (PubMed:32424362).1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q91WS2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q91WS2

PeptideAtlas

More...PeptideAtlasi		Q91WS2

PRoteomics IDEntifications database

More...PRIDEi		Q91WS2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		253083 [Q91WS2-1]
253084 [Q91WS2-2]
253085 [Q91WS2-3]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q91WS2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the gastrointestinal tract, predominantly in colonic myofibroblasts and in colonic epithelial and endothelial cells. Within the intestinal mucosa, highly expressed by goblet cells. Also expressed in hepatocytes and in immune cells, including CD4+ and CD8+ T-cells, dendritic cells, mastocytes and peritoneal macrophages, as well as in lung, kidney, bladder and gonads.5 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Up-regulated transiently following sterile or LPS-induced sciatic nerve injury with a peak after 4 hours.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by rosiglitazone, a PPARG agonist, in CT26 cells. Down-regulated by CRH during water-avoidance stress.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000038745, Expressed in liver and 94 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q91WS2, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homomultimer; forms the NLRP6 inflammasome polymeric complex, a filament composed of homopolymers in response to pathogens and other damage-associated signals (PubMed:34678144). The core of NLRP6 inflammasomes consists of a signal sensor component (NLRP6), an adapter (PYCARD/ASC), which recruits effector proinflammatory caspases (CASP1 and CASP4) (PubMed:34678144).

Interacts (via pyrin domain) with PYCARD/ASC (via pyrin domain); interaction takes place following NLRP6 activation and formation of liquid-liquid phase separation (LLPS), initiating nucleation which greatly enhances further addition of soluble PYCARD/ASC molecules to the speck in a prion-like polymerization process (PubMed:32424362, PubMed:34678144). Clustered PYCARD/ASC nucleates the formation of CASP1 (or possibly CASP4) filaments through the interaction of their respective CARD domains, acting as a platform for CASP1 polymerization (PubMed:34678144). CASP1 filament formation increases local enzyme concentration, resulting in trans-autocleavage and activation (PubMed:34678144). Active CASP1 then processes IL1B and IL18 precursors, leading to the release of mature cytokines in the extracellular milieu and inflammatory response (PubMed:34678144).

Interacts with DHX15 (PubMed:26494172).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-61874N

Protein interaction database and analysis system

More...IntActi		Q91WS2, 3 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000139170

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q91WS2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q91WS2

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 128PyrinPROSITE-ProRule annotationAdd BLAST92
Domaini194 – 511NACHTPROSITE-ProRule annotationAdd BLAST318
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati460 – 485LRR 1Sequence analysisAdd BLAST26
Repeati635 – 658LRR 2Sequence analysisAdd BLAST24
Repeati837 – 860LRR 3Sequence analysisAdd BLAST24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni350 – 354Disordered1 Publication5
Regioni577 – 608DisorderedSequence analysisAdd BLAST32

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The poly-Lys disordered region (350-354) mediates the formation of liquid-liquid phase separation (LLPS), an essential step for nucleation and formation of the NLRP6 inflammasome complex.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502SANB, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162758

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002274_2_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q91WS2

Identification of Orthologs from Complete Genome Data

More...OMAi		GLAWPRC

Database of Orthologous Groups

More...OrthoDBi		114368at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q91WS2

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.533.10, 1 hit
3.40.50.300, 1 hit
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004020, DAPIN
IPR011029, DEATH-like_dom_sf
IPR032675, LRR_dom_sf
IPR007111, NACHT_NTPase
IPR041267, NLRP_HD2
IPR041075, NOD2_WH
IPR027417, P-loop_NTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05729, NACHT, 1 hit
PF17776, NLRC4_HD2, 1 hit
PF17779, NOD2_WH, 1 hit
PF02758, PYRIN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01289, PYRIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47986, SSF47986, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50824, DAPIN, 1 hit
PS50837, NACHT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q91WS2-1) [UniParc]FASTAAdd to basket
Also known as: NAVR1 Publication

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAAGASCSS VDAVARELLM ATLEELSQEQ LKRFRHKLRD APLDGRSIPW 
        60         70         80         90        100
GRLERSDAVD LVDKLIEFYE PVPAVEMTRQ VLKRSDIRDV ASRLKQQQLQ 
       110        120        130        140        150
KLGPTSVLLS VSAFKKKYRE HVLRQHAKVK ERNARSVKIN KRFTKLLIAP 
       160        170        180        190        200
GTGAVEDELL GPLGEPEPER ARRSDTHTFN RLFRGNDEES SQPLTVVLQG 
       210        220        230        240        250
PAGIGKTMAA KKILYDWAAG KLYHSQVDFA FFMPCGELLE RPGKRSLADL 
       260        270        280        290        300
VLDQCPDRAW PVKRILAQPN RLLFILDGAD ELPTLPSSEA TPCKDPLEAT 
       310        320        330        340        350
SGLRVLSGLL SQELLPGARL LVTTRHAATG RLQGRLCSPQ CAEIRGFSDK 
       360        370        380        390        400
DKKKYFFKFF RDERKAERAY RFVKENETLF ALCFVPFVCW IVCTVLQQQL 
       410        420        430        440        450
ELGRDLSRTS KTTTSVYLLF ITSMLKSAGT NGPRVQGELR TLCRLAREGI 
       460        470        480        490        500
LDHHKAQFSE EDLEKLKLRG SQVQTIFLNK KEIPGVLKTE VTYQFIDQSF 
       510        520        530        540        550
QEFLAALSYL LEAERTPGTP AGGVQKLLNS DAELRGHLAL TTRFLFGLLN 
       560        570        580        590        600
TEGLRDIGNH FGCVVPDHVK KDTLRWVQGQ SHPKGPPVGA KKTAELEDIE 
       610        620        630        640        650
DAEEEEEEEE DLNFGLELLY CLYETQEEDF VRQALSSLPE IVLERVRLTR 
       660        670        680        690        700
MDLEVLNYCV QCCPDGQALR LVSCGLVAAK EKKKKKKSLV KRLKGSQSTK 
       710        720        730        740        750
KQPPVSLLRP LCETMTTPKC HLSVLILSHC RLPDAVCRDL SEALKVAPAL 
       760        770        780        790        800
RELGLLQSRL TNTGLRLLCE GLAWPKCQVK TLRMQLPDLQ EVINYLVIVL 
       810        820        830        840        850
QQSPVLTTLD LSGCQLPGVI VEPLCAALKH PKCSLKTLSL TSVELSENSL 
       860 
RDLQAVKTSK PDLSIIYSK
Length:869
Mass (Da):97,402
Last modified:August 21, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i801498F67872969F
GO
Isoform 2 (identifier: Q91WS2-2) [UniParc]FASTAAdd to basket
Also known as: Angiotensin-vasopressin receptor1 Publication, AVR1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.

Note: Produced by alternative promoter usage.Curated
Show »
Length:446
Mass (Da):49,706
Checksum:iE88403A1F46F597B
GO
Isoform 3 (identifier: Q91WS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MDAAGASCS → MYCPGAPCGECAMCDPGCFGGSGTGPIQVASVMITLLIP

Note: Produced by alternative splicing.Curated
Show »
Length:899
Mass (Da):100,439
Checksum:iC12DB9DF6BE7A8BC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QNS0E9QNS0_MOUSE
NACHT, LRR and PYD domains-containi...
Nlrp6
882Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ACN32212 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti429G → F in ACN32212 (PubMed:20923861).Curated1
Sequence conflicti454Missing in ACN32212 (PubMed:20923861).Curated1
Sequence conflicti733P → R in ACN32212 (PubMed:20923861).Curated1
Sequence conflicti869K → KIRHTSPASEG in ACN32212 (PubMed:20923861).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0423011 – 423Missing in isoform 2. 2 PublicationsAdd BLAST423
Alternative sequenceiVSP_0579711 – 9MDAAGASCS → MYCPGAPCGECAMCDPGCFG GSGTGPIQVASVMITLLIP in isoform 3. 9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
JF810536 mRNA Translation: AEI54131.1
AC107815 Genomic DNA No translation available.
AC162287 Genomic DNA No translation available.
BC013519 mRNA Translation: AAH13519.1
BC031139 mRNA Translation: AAH31139.1
FJ222825 mRNA Translation: ACN32212.1 Frameshift.
AY355343 mRNA Translation: AAR14740.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS40178.2 [Q91WS2-1]

NCBI Reference Sequences

More...RefSeqi		NP_598707.2, NM_133946.2 [Q91WS2-1]
XP_006536212.1, XM_006536149.3 [Q91WS2-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000183845; ENSMUSP00000139357; ENSMUSG00000038745 [Q91WS2-1]
ENSMUST00000184560; ENSMUSP00000139170; ENSMUSG00000038745 [Q91WS2-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		101613

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:101613

UCSC genome browser

More...UCSCi		uc009kiv.3, mouse [Q91WS2-1]
uc029wpm.2, mouse

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JF810536 mRNA Translation: AEI54131.1
AC107815 Genomic DNA No translation available.
AC162287 Genomic DNA No translation available.
BC013519 mRNA Translation: AAH13519.1
BC031139 mRNA Translation: AAH31139.1
FJ222825 mRNA Translation: ACN32212.1 Frameshift.
AY355343 mRNA Translation: AAR14740.1
CCDSiCCDS40178.2 [Q91WS2-1]
RefSeqiNP_598707.2, NM_133946.2 [Q91WS2-1]
XP_006536212.1, XM_006536149.3 [Q91WS2-3]

3D structure databases

SMRiQ91WS2
ModBaseiSearch...

Protein-protein interaction databases

DIPiDIP-61874N
IntActiQ91WS2, 3 interactors
STRINGi10090.ENSMUSP00000139170

PTM databases

PhosphoSitePlusiQ91WS2

Proteomic databases

MaxQBiQ91WS2
PaxDbiQ91WS2
PeptideAtlasiQ91WS2
PRIDEiQ91WS2
ProteomicsDBi253083 [Q91WS2-1]
253084 [Q91WS2-2]
253085 [Q91WS2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		58845, 237 antibodies from 29 providers

The DNASU plasmid repository

More...DNASUi		101613

Genome annotation databases

EnsembliENSMUST00000183845; ENSMUSP00000139357; ENSMUSG00000038745 [Q91WS2-1]
ENSMUST00000184560; ENSMUSP00000139170; ENSMUSG00000038745 [Q91WS2-3]
GeneIDi101613
KEGGimmu:101613
UCSCiuc009kiv.3, mouse [Q91WS2-1]
uc029wpm.2, mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		171389
MGIiMGI:2141990, Nlrp6
VEuPathDBiHostDB:ENSMUSG00000038745

Phylogenomic databases

eggNOGiENOG502SANB, Eukaryota
GeneTreeiENSGT00940000162758
HOGENOMiCLU_002274_2_2_1
InParanoidiQ91WS2
OMAiGLAWPRC
OrthoDBi114368at2759
PhylomeDBiQ91WS2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		101613, 1 hit in 65 CRISPR screens

Protein Ontology

More...PROi		PR:Q91WS2
RNActiQ91WS2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000038745, Expressed in liver and 94 other tissues
GenevisibleiQ91WS2, MM

Family and domain databases

Gene3Di1.10.533.10, 1 hit
3.40.50.300, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020, DAPIN
IPR011029, DEATH-like_dom_sf
IPR032675, LRR_dom_sf
IPR007111, NACHT_NTPase
IPR041267, NLRP_HD2
IPR041075, NOD2_WH
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF05729, NACHT, 1 hit
PF17776, NLRC4_HD2, 1 hit
PF17779, NOD2_WH, 1 hit
PF02758, PYRIN, 1 hit
SMARTiView protein in SMART
SM01289, PYRIN, 1 hit
SUPFAMiSSF47986, SSF47986, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50824, DAPIN, 1 hit
PS50837, NACHT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNLRP6_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q91WS2
Secondary accession number(s): C9W978
, F8UKQ6, Q67EY0, Q8K0L4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: August 21, 2007
Last modified: February 23, 2022
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again