Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activating signal cointegrator 1 complex subunit 2

Gene

Ascc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in DNA damage repair as component of the ASCC complex. Recruits ASCC3 and ALKBH3 to sites of DNA damage by binding to polyubiquitinated proteins that have 'Lys-63'-linked polyubiquitin chains. Part of the ASC-1 complex that enhances NF-kappa-B, SRF and AP1 transactivation.By similarity

GO - Biological processi

Keywordsi

Biological processDNA damage, DNA repair, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 2
Alternative name(s):
ASC-1 complex subunit p100
Trip4 complex subunit p100
Gene namesi
Name:Ascc2
Synonyms:Asc1p100
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1922702 Ascc2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000646901 – 749Activating signal cointegrator 1 complex subunit 2Add BLAST749

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei233PhosphothreonineBy similarity1
Modified residuei625PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ91WR3
PaxDbiQ91WR3
PeptideAtlasiQ91WR3
PRIDEiQ91WR3

PTM databases

iPTMnetiQ91WR3
PhosphoSitePlusiQ91WR3

Miscellaneous databases

PMAP-CutDBiQ91WR3

Expressioni

Gene expression databases

BgeeiENSMUSG00000020412 Expressed in 263 organ(s), highest expression level in paneth cell
GenevisibleiQ91WR3 MM

Interactioni

Subunit structurei

Identified in the ASCC complex that contains ASCC1, ASCC2 and ASCC3. Interacts directly with ASCC3. The ASCC complex interacts with ALKBH3. Interacts (via CUE domain) with 'Lys-63'-linked polyubiquitin chains, but not with 'Lys-48'-linked polyubiquitin chains. Part of the ASC-1 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3. Interacts with CSRP1. Interacts with PRPF8, a component of the spliceosome.By similarity

Protein-protein interaction databases

BioGridi217491, 1 interactor
STRINGi10090.ENSMUSP00000063272

Structurei

3D structure databases

ProteinModelPortaliQ91WR3
SMRiQ91WR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini465 – 508CUEPROSITE-ProRule annotationAdd BLAST44

Sequence similaritiesi

Belongs to the ASCC2 family.Curated

Phylogenomic databases

eggNOGiKOG4501 Eukaryota
ENOG410XSUE LUCA
GeneTreeiENSGT00390000018806
HOGENOMiHOG000234347
HOVERGENiHBG050589
InParanoidiQ91WR3
KOiK18667
OMAiHMQGLTG
OrthoDBiEOG091G06RW
PhylomeDBiQ91WR3
TreeFamiTF323459

Family and domain databases

InterProiView protein in InterPro
IPR003892 CUE
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF02845 CUE, 1 hit
SMARTiView protein in SMART
SM00546 CUE, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
PROSITEiView protein in PROSITE
PS51140 CUE, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q91WR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPALPLDQLQ ITHKDPKTGQ PKTSAALNPE QKADRYFVLY KPPPKDNIPA
60 70 80 90 100
LVEEYLERAN FVANDLDWLL ALPHDKFWCQ VIFDETLQKC LDSYLHYVPR
110 120 130 140 150
KFDEWVAPTP EVADMQNHLH RSVFLTFLRM STHKESKDHF ISPSAFGEIL
160 170 180 190 200
YNNFLFDIPK ILDLCVLFGK GNSPLLQKMI GNIFTQQPSY YTDLDETIPT
210 220 230 240 250
ILQVFSNILQ HCGLQGDGTS TTPQKLGERS PLTPSDMPLL ELKDIVLYLC
260 270 280 290 300
DTSTTLWAFL DIFPLACQTF QKHDFCYRLA SFYEMAIPEL ESAIKKRRLE
310 320 330 340 350
DSKLLGDMWQ RLSHSKKKLM EVFHIILNQI CLLPILESSC DNIQGFIEEF
360 370 380 390 400
LQIFSSLLQE KRFLRDYDTF SPVAEDISLL QQASSALDET RTAYILQAVE
410 420 430 440 450
SAWEGVDRQK IKDIKDPPRA KGSNNEVTVT AEPVSEMPSQ LENLEEDEEC
460 470 480 490 500
MGAAAALGPA VSGVELDSLI SQVKDLLPDL GEGFILACLE HYSYDSEQVI
510 520 530 540 550
NNILEDRLAP ELSQLDRGLE RQVKPDPTPL LSSRHNIFQN DEFDVFSRDS
560 570 580 590 600
VDLSRVHKGR RKEENVRSLV NDKQAVVAQW QRYQKYSVVV EEVPLQPGEY
610 620 630 640 650
QADDYEDEYD DTYDGNQVGA NDADSDDELI SRRPFTIPQV LRTKMPGEVQ
660 670 680 690 700
EEEWDEEDEV EEEAPKPDHF IQDPAVLREK AEARRMAFLA RKGYRPENST
710 720 730 740
AVTGGPRGHG QSRETTQERR KKEANKAARA NHNRRTMADR KRSKGMIPS
Length:749
Mass (Da):85,653
Last modified:December 1, 2001 - v1
Checksum:i9923D4BE00B7C3AB
GO
Isoform 2 (identifier: Q91WR3-2) [UniParc]FASTAAdd to basket
Also known as: 100S

The sequence of this isoform differs from the canonical sequence as follows:
     522-561: Missing.

Show »
Length:709
Mass (Da):80,976
Checksum:iA4FE31AA6E9B3BA6
GO
Isoform 3 (identifier: Q91WR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-749: NRRTMADRKRSKGMIPS → KSFCAPEMDYERPEGLRRGAELAVCPWCLSSGCVCPC

Note: Incomplete sequence.
Show »
Length:769
Mass (Da):87,713
Checksum:i47B08C3AF9548238
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011012522 – 561Missing in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_011013733 – 749NRRTM…GMIPS → KSFCAPEMDYERPEGLRRGA ELAVCPWCLSSGCVCPC in isoform 3. CuratedAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA Translation: BAC33480.1
AK051387 mRNA Translation: BAC34621.1
AL606521 Genomic DNA No translation available.
BC013537 mRNA Translation: AAH13537.1
BC024840 mRNA Translation: AAH24840.1
CCDSiCCDS24387.1 [Q91WR3-1]
RefSeqiNP_083567.1, NM_029291.1 [Q91WR3-1]
UniGeneiMm.439906

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412 [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412 [Q91WR3-2]
GeneIDi75452
KEGGimmu:75452
UCSCiuc007hva.2 mouse [Q91WR3-1]
uc011xqz.2 mouse [Q91WR3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA Translation: BAC33480.1
AK051387 mRNA Translation: BAC34621.1
AL606521 Genomic DNA No translation available.
BC013537 mRNA Translation: AAH13537.1
BC024840 mRNA Translation: AAH24840.1
CCDSiCCDS24387.1 [Q91WR3-1]
RefSeqiNP_083567.1, NM_029291.1 [Q91WR3-1]
UniGeneiMm.439906

3D structure databases

ProteinModelPortaliQ91WR3
SMRiQ91WR3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi217491, 1 interactor
STRINGi10090.ENSMUSP00000063272

PTM databases

iPTMnetiQ91WR3
PhosphoSitePlusiQ91WR3

Proteomic databases

EPDiQ91WR3
PaxDbiQ91WR3
PeptideAtlasiQ91WR3
PRIDEiQ91WR3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412 [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412 [Q91WR3-2]
GeneIDi75452
KEGGimmu:75452
UCSCiuc007hva.2 mouse [Q91WR3-1]
uc011xqz.2 mouse [Q91WR3-2]

Organism-specific databases

CTDi84164
MGIiMGI:1922702 Ascc2

Phylogenomic databases

eggNOGiKOG4501 Eukaryota
ENOG410XSUE LUCA
GeneTreeiENSGT00390000018806
HOGENOMiHOG000234347
HOVERGENiHBG050589
InParanoidiQ91WR3
KOiK18667
OMAiHMQGLTG
OrthoDBiEOG091G06RW
PhylomeDBiQ91WR3
TreeFamiTF323459

Miscellaneous databases

ChiTaRSiAscc2 mouse
PMAP-CutDBiQ91WR3
PROiPR:Q91WR3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020412 Expressed in 263 organ(s), highest expression level in paneth cell
GenevisibleiQ91WR3 MM

Family and domain databases

InterProiView protein in InterPro
IPR003892 CUE
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF02845 CUE, 1 hit
SMARTiView protein in SMART
SM00546 CUE, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
PROSITEiView protein in PROSITE
PS51140 CUE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiASCC2_MOUSE
AccessioniPrimary (citable) accession number: Q91WR3
Secondary accession number(s): Q5NCK1
, Q8BKM9, Q8BX60, Q8R1B9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 112 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again