UniProtKB - Q91V41 (RAB14_MOUSE)

BLAST

>sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus OX=10090 GN=Rab14 PE=1 SV=3
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI
KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII
LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGS
LDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

Align
Format
Add to basket Added to basket
History
Entry version 156 (07 Nov 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Ras-related protein Rab-14

Gene

Rab14

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Regulates, together with its guanine nucleotide exchange factor, DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion (By similarity). Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity).By similarity1 Publication

Regions

Feature key	Position(s)	DescriptionActions	Length
Nucleotide bindingⁱ	18 – 26	GTPBy similarity	9
Nucleotide bindingⁱ	66 – 70	GTPBy similarity	5
Nucleotide bindingⁱ	124 – 127	GTPBy similarity	4
Nucleotide bindingⁱ	154 – 156	GTPBy similarity	3

GO - Molecular functionⁱ

GDP binding Source: UniProtKB
GTPase activity Source: UniProtKB
GTP binding Source: UniProtKB
myosin V binding Source: MGI

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

apical protein localization Source: MGI
body fluid secretion Source: MGI
defense response to bacterium Source: InterPro
endocytic recycling Source: UniProtKB
fibroblast growth factor receptor signaling pathway
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 21238925
Golgi to endosome transport
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 21238925
intracellular protein transport
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
phagolysosome assembly involved in apoptotic cell clearance
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
Rab protein signal transduction
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of embryonic development
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 21238925
regulation of protein localization Source: UniProtKB

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Protein transport, Transport
Ligand	GTP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactomeⁱ	R-MMU-1660499 Synthesis of PIPs at the plasma membrane R-MMU-6798695 Neutrophil degranulation R-MMU-8873719 RAB geranylgeranylation R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Reactomeⁱ

R-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-6798695 Neutrophil degranulation
R-MMU-8873719 RAB geranylgeranylation
R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Ras-related protein Rab-14
Gene namesⁱ	Name:Rab14
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 2

Organism-specific databases

MGIⁱ	MGI:1915615 Rab14

Keywords - Cellular componentⁱ

Cytoplasmic vesicle, Endosome, Golgi apparatus, Membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedBy similarity
ChainⁱPRO_0000121186	2 – 215	Ras-related protein Rab-14Add BLAST		214

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineBy similarity	1
Lipidationⁱ	213	S-geranylgeranyl cysteineBy similarity	1
Modified residueⁱ	215	Cysteine methyl esterBy similarity	1
Lipidationⁱ	215	S-geranylgeranyl cysteineBy similarity	1

Keywords - PTMⁱ

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

EPDⁱ	Q91V41
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q91V41
PaxDbⁱ	Q91V41
PRIDEⁱ	Q91V41

2D gel databases

UCD-2DPAGEⁱ	Q91V41

UCD-2DPAGEⁱ

Q91V41

PTM databases

iPTMnetⁱ	Q91V41
PhosphoSitePlusⁱ	Q91V41
SwissPalmⁱ	Q91V41

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000026878 Expressed in 296 organ(s), highest expression level in secondary oocyte
CleanExⁱ	MM_RAB14
ExpressionAtlasⁱ	Q91V41 baseline and differential
Genevisibleⁱ	Q91V41 MM

Interactionⁱ

Subunit structureⁱ

Interacts with ZFYVE20 (By similarity). Interacts with KIF16B.By similarity1 Publication

GO - Molecular functionⁱ

myosin V binding Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	212822, 8 interactors
IntActⁱ	Q91V41, 11 interactors
Molecular INTeraction database More...MINTⁱ	Q91V41
STRINGⁱ	10090.ENSMUSP00000028238

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q91V41
SMRⁱ	Q91V41
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	40 – 48	Effector regionBy similarity		9

Sequence similaritiesⁱ

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGⁱ	KOG0097 Eukaryota COG1100 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000118841
HOGENOMⁱ	HOG000233968
HOVERGENⁱ	HBG009351
InParanoidⁱ	Q91V41
KEGG Orthology (KO) More...KOⁱ	K07881
OMAⁱ	GVQHKPA
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0QOB
PhylomeDBⁱ	Q91V41
TreeFamⁱ	TF300032

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd04122 Rab14, 1 hit
InterProⁱ	View protein in InterPro IPR027417 P-loop_NTPase IPR030702 Rab14 IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase
PANTHERⁱ	PTHR24073:SF654 PTHR24073:SF654, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00071 Ras, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00231 small_GTP, 1 hit
PROSITEⁱ	View protein in PROSITE PS51419 RAB, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q91V41-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MATAPYNYSY IFKYIIIGDM GVGKSCLLHQ FTEKKFMADC PHTIGVEFGT 
        60         70         80         90        100
RIIEVSGQKI KLQIWDTAGQ ERFRAVTRSY YRGAAGALMV YDITRRSTYN 
       110        120        130        140        150
HLSSWLTDAR NLTNPNTVII LIGNKADLEA QRDVTYEEAK QFAEENGLLF 
       160        170        180        190        200
LEASAKTGEN VEDAFLEAAK KIYQNIQDGS LDLNAAESGV QHKPSAPQGG 
       210 
RLTSEPQPQR EGCGC

Length:215

Mass (Da):23,897

Last modified:January 23, 2007 - v3

Checksum:ⁱBC8A8B98FB9944AC

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q50HX3	Q50HX3_MOUSE	RAB14 protein variant RAB14 protein variant (Ras-related protein Rab-14)	Rab14 rab14	197	Annotation score:
A0A2R8VHW9	A0A2R8VHW9_MOUSE	Ras-related protein Rab-14 Ras-related protein Rab-14	Rab14	83	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK002704 mRNA Translation: BAB22298.1 BC009085 mRNA Translation: AAH09085.1 BC025139 mRNA Translation: AAH25139.1 BC056648 mRNA Translation: AAH56648.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS15959.1
NCBI Reference Sequences More...RefSeqⁱ	NP_080973.1, NM_026697.3
UniGeneⁱ	Mm.198264

Genome annotation databases

Ensemblⁱ	ENSMUST00000028238; ENSMUSP00000028238; ENSMUSG00000026878
GeneIDⁱ	68365
KEGGⁱ	mmu:68365
UCSC genome browser More...UCSCⁱ	uc008jjz.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q91V41	Ras-related protein Rab-14	)	HUMAN		215	UniRef100_P61106
Ras-related protein Rab-14		CHICK		215
Ras-related protein Rab-14		PONAB		215
Uncharacterized protein		GASAC		172
Putative ras-related protein Rab-14		SCOMX		543
+123

Protein	Similar proteins		Species	Score	Length	Source
Q91V41	Ras-related protein Rab-14	)	HUMAN		215	UniRef90_P61106
Ras-related protein Rab-14		CHICK		215
Ras-related protein Rab-14		PONAB		215
Uncharacterized protein		GASAC		172
Putative ras-related protein Rab-14		SCOMX		543
+123

Protein	Similar proteins		Species	Score	Length	Source
Q91V41	Ras-related protein Rab-14	)	HUMAN		215	UniRef50_P61106
Ras-related protein Rab-14		CHICK		215
Ras-related protein Rab-14		PONAB		215
Uncharacterized protein		GASAC		172
Putative ras-related protein Rab-14		SCOMX		543
+123

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK002704 mRNA Translation: BAB22298.1 BC009085 mRNA Translation: AAH09085.1 BC025139 mRNA Translation: AAH25139.1 BC056648 mRNA Translation: AAH56648.1
CCDSⁱ	CCDS15959.1
RefSeqⁱ	NP_080973.1, NM_026697.3
UniGeneⁱ	Mm.198264

3D structure databases

ProteinModelPortalⁱ	Q91V41
SMRⁱ	Q91V41
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	212822, 8 interactors
IntActⁱ	Q91V41, 11 interactors
MINTⁱ	Q91V41
STRINGⁱ	10090.ENSMUSP00000028238

PTM databases

iPTMnetⁱ	Q91V41
PhosphoSitePlusⁱ	Q91V41
SwissPalmⁱ	Q91V41

2D gel databases

UCD-2DPAGEⁱ	Q91V41

UCD-2DPAGEⁱ

Q91V41

Proteomic databases

EPDⁱ	Q91V41
MaxQBⁱ	Q91V41
PaxDbⁱ	Q91V41
PRIDEⁱ	Q91V41

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000028238; ENSMUSP00000028238; ENSMUSG00000026878
GeneIDⁱ	68365
KEGGⁱ	mmu:68365
UCSCⁱ	uc008jjz.1 mouse

Organism-specific databases

CTDⁱ	51552
MGIⁱ	MGI:1915615 Rab14

Phylogenomic databases

eggNOGⁱ	KOG0097 Eukaryota COG1100 LUCA
GeneTreeⁱ	ENSGT00760000118841
HOGENOMⁱ	HOG000233968
HOVERGENⁱ	HBG009351
InParanoidⁱ	Q91V41
KOⁱ	K07881
OMAⁱ	GVQHKPA
OrthoDBⁱ	EOG091G0QOB
PhylomeDBⁱ	Q91V41
TreeFamⁱ	TF300032

Enzyme and pathway databases

Reactomeⁱ	R-MMU-1660499 Synthesis of PIPs at the plasma membrane R-MMU-6798695 Neutrophil degranulation R-MMU-8873719 RAB geranylgeranylation R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Reactomeⁱ

R-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-6798695 Neutrophil degranulation
R-MMU-8873719 RAB geranylgeranylation
R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRSⁱ	Rab14 mouse
Protein Ontology More...PROⁱ	PR:Q91V41
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000026878 Expressed in 296 organ(s), highest expression level in secondary oocyte
CleanExⁱ	MM_RAB14
ExpressionAtlasⁱ	Q91V41 baseline and differential
Genevisibleⁱ	Q91V41 MM

Family and domain databases

CDDⁱ	cd04122 Rab14, 1 hit
InterProⁱ	View protein in InterPro IPR027417 P-loop_NTPase IPR030702 Rab14 IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase
PANTHERⁱ	PTHR24073:SF654 PTHR24073:SF654, 1 hit
Pfamⁱ	View protein in Pfam PF00071 Ras, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00231 small_GTP, 1 hit
PROSITEⁱ	View protein in PROSITE PS51419 RAB, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RAB14_MOUSE
Accessionⁱ	Q91V41Primary (citable) accession number: Q91V41
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 26, 2004
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 156 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q91V41 (RAB14_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Ras-related protein Rab-14

Rab14

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Golgi apparatus

Endosome

Other locations

Cytosol

Endoplasmic reticulum

Endosome

Golgi apparatus

Lysosome

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ