Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q91V12 (BACH_MOUSE)

Entry version 158 (12 Aug 2020)
Sequence version 2 (12 Feb 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

Acot7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:15288813). Acyl-coenzyme A thioesterase 7/ACOT7 preferentially hydrolyzes palmitoyl-CoA, but has a broad specificity acting on other fatty acyl-CoAs with chain-lengths of C8-C18 (Probable). May play an important physiological function in brain (PubMed:15288813).1 Publication1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=16 µM for palmitoyl-CoA (isoform A at 30 degrees Celsius)1 Publication
  2. KM=12 µM for palmitoyl-CoA (isoform D at 30 degrees Celsius)1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: fatty acid metabolism

    This protein is involved in the pathway fatty acid metabolism, which is part of Lipid metabolism.1 Publication
    View all proteins of this organism that are known to be involved in the pathway fatty acid metabolism and in Lipid metabolism.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei671 Publication1
    Active sitei2561 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Serine esterase
    Biological processFatty acid metabolism, Lipid metabolism

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		3.1.2.2, 3474

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-MMU-77289, Mitochondrial Fatty Acid Beta-Oxidation

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...    SABIO-RKi    		Q91V12

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...    UniPathwayi    		UPA00199

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2By similarity)
    Alternative name(s):
    Acyl-CoA thioesterase 7
    Brain acyl-CoA hydrolase
    Short name:
    BACH
    CTE-IIa
    Short name:
    CTE-II
    Long chain acyl-CoA thioester hydrolase
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Acot7
    Synonyms:Bach
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

    Organism-specific databases

    Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

    More...    MGIi    		MGI:1917275, Acot7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi67N → A: Dramatic reduction in catalytic activity. 1 Publication1
    Mutagenesisi256D → A: Dramatic reduction in catalytic activity. 1 Publication1

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538071 – 381Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST381

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei169N6-acetyllysineBy similarity1
    Modified residuei199N6-acetyllysineBy similarity1
    Modified residuei284N6-acetyllysineBy similarity1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q91V12

    PeptideAtlas

    More...    PeptideAtlasi    		Q91V12

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q91V12

    2D gel databases

    REPRODUCTION-2DPAGE

    More...    REPRODUCTION-2DPAGEi    		Q91V12

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q91V12

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q91V12

    SwissPalm database of S-palmitoylation events

    More...    SwissPalmi    		Q91V12

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed with highest levels in brain. High levels also found in thymus, large intestine and testis. Negligible in muscle and adipose tissue. In the central and peripheral nervous systems, displays a predominantly neuronal localization with highest expression in cell bodies and neurites.1 Publication

    <p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

    Detected in the brain as early as embryonic day (E) 11.5. The level was low until 12.5 dpc, but promptly elevated to a peak 7 days after birth. Thereafter, it declined somewhat and reached a steady-state level in adulthood. These changes in BACH expression were approximately reflected in the palmitoyl-CoA hydrolyzing activity in the developing mouse brain, and the time course was quite similar to that of microtubule-associated protein 2 (MAP2) expression. Induced during embryogenesis in association with neuronal differentiation, and persists after terminal differentiation into neurons in postnatal stages, resulting in the constitutive high expression of BACH in the adult brain in a neuron-specific manner.1 Publication

    <p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Up-Regulated in activated macrophages.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSMUSG00000028937, Expressed in ventral horn of spinal cord and 344 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		Q91V12, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q91V12, MM

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homohexamer.

    1 Publication

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		213825, 9 interactors

    Database of interacting proteins

    More...    DIPi    		DIP-54691N

    Protein interaction database and analysis system

    More...    IntActi    		Q91V12, 4 interactors

    Molecular INTeraction database

    More...    MINTi    		Q91V12

    STRING: functional protein association networks

    More...    STRINGi    		10090.ENSMUSP00000074827

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		Q91V12, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1381
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q91V12

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...    EvolutionaryTracei    		Q91V12

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini51 – 169HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
    Domaini225 – 339HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

    <p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    Both HotDog ACOT-type hydrolase domains are required for efficient activity.

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG2763, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000155229

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_050164_0_1_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q91V12

    KEGG Orthology (KO)

    More...    KOi    		K17360

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		PTDVNWG

    Database of Orthologous Groups

    More...    OrthoDBi    		1069806at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q91V12

    TreeFam database of animal gene trees

    More...    TreeFami    		TF329579

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR040170, Cytosol_ACT
    IPR033120, HOTDOG_ACOT
    IPR029069, HotDog_dom_sf
    IPR006683, Thioestr_dom

    The PANTHER Classification System

    More...    PANTHERi    		PTHR11049, PTHR11049, 2 hits

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF03061, 4HBT, 2 hits

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF54637, SSF54637, 2 hits

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS51770, HOTDOG_ACOT, 2 hits

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

    Isoform B (identifier: Q91V12-1) [UniParc]FASTAAdd to basket
    Also known as: mBACHb

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MKLLVGTLRL WEVGRQVAFS SLTPGQECSG LRKTFWAAMR AVRTRADHQK 
            60         70         80         90        100
    LGHCVTMGRI MRPDDANVAG NVHGGTILKM IEEAGAIIST RHCNSQNGER 
           110        120        130        140        150
    CVAALARVER TDFLSPMCIG EVAHVSAEIT YTSKHSVEVQ VHVMSENILT 
           160        170        180        190        200
    GTKKLTNKAT LWYVPLSLKN VDKVLEVPPI VYLRQEQEEE GRKRYEAQKL 
           210        220        230        240        250
    ERMETKWRNG DIVQPVLNPE PNTVSYSQSS LIHLVGPSDC TLHGFVHGGV 
           260        270        280        290        300
    TMKLMDEVAG IVAARHCKTN IVTASVDAIN FHDKIRKGCV ITISGRMTFT 
           310        320        330        340        350
    SNKSMEIEVL VDADPVVDNS QKRYRAASAF FTYVSLNQEG KPMPVPQLVP 
           360        370        380 
    ETEDEKKRFE EGKGRYLQMK AKRQGHTEPQ P
    Length:381
    Mass (Da):42,537
    Last modified:February 12, 2003 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i813852DBEB6834C4
    GO
    Isoform A (identifier: Q91V12-2) [UniParc]FASTAAdd to basket
    Also known as: mBach, mBACHa, 43-kDa BACH

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: MKLLVGTLRLWEVGRQVAFSSLTPGQECSGLRKTFWAAMRAVRTRADHQKLGHCVTMG → MSGPTTDTPAAIQIC

    Note: Major isoform.Curated
    Show »
    Length:338
    Mass (Da):37,555
    Checksum:iE1DB2E445494D477
    GO
    Isoform C (identifier: Q91V12-3) [UniParc]FASTAAdd to basket
    Also known as: mBACHc

    The sequence of this isoform differs from the canonical sequence as follows:
         1-59: MKLLVGTLRL...KLGHCVTMGR → MLTLHRALALRVLRKEVTEAYLREKVKQ

    Show »
    Length:350
    Mass (Da):39,259
    Checksum:i306F06A966F6F40E
    GO
    Isoform D (identifier: Q91V12-4) [UniParc]FASTAAdd to basket
    Also known as: 50-kDa BACH

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: MKLLVGTLRL...QKLGHCVTMG → MAPPLPSSSM...TDTPAAIQIC

    Show »
    Length:379
    Mass (Da):41,616
    Checksum:i832431B7D412E6FC
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    E9PYH2E9PYH2_MOUSE
    Cytosolic acyl coenzyme A thioester...
    Acot7
    		384Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti186E → D in BAE31092 (PubMed:16141072).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0001571 – 59MKLLV…VTMGR → MLTLHRALALRVLRKEVTEA YLREKVKQ in isoform C. 1 PublicationAdd BLAST59
    Alternative sequenceiVSP_0001581 – 58MKLLV…CVTMG → MSGPTTDTPAAIQIC in isoform A. 3 PublicationsAdd BLAST58
    Alternative sequenceiVSP_0169551 – 58MKLLV…CVTMG → MAPPLPSSSMAPPRLIHSGT GLLDTCSQIPPPPPSSAVAA KMSGPTTDTPAAIQIC in isoform D. 1 PublicationAdd BLAST58

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		AB088411 mRNA Translation: BAC20217.1
    AB088412 mRNA Translation: BAC20218.1
    AB049821 mRNA Translation: BAB61731.1
    AB207243 mRNA Translation: BAD91166.1
    AK152277 mRNA Translation: BAE31092.1
    AL611985 Genomic DNA No translation available.
    AL671869 Genomic DNA No translation available.
    AL772240 Genomic DNA No translation available.
    BC013507 mRNA Translation: AAH13507.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS51390.1 [Q91V12-4]
    CCDS51391.2 [Q91V12-1]
    CCDS51392.1 [Q91V12-3]

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001139529.1, NM_001146057.1 [Q91V12-1]
    NP_001139530.1, NM_001146058.1 [Q91V12-3]
    NP_579926.2, NM_133348.2 [Q91V12-4]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENSMUST00000030779; ENSMUSP00000030779; ENSMUSG00000028937 [Q91V12-1]
    ENSMUST00000075363; ENSMUSP00000074827; ENSMUSG00000028937 [Q91V12-4]
    ENSMUST00000105652; ENSMUSP00000101277; ENSMUSG00000028937 [Q91V12-3]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		70025

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		mmu:70025

    UCSC genome browser

    More...    UCSCi    		uc008vzx.2, mouse [Q91V12-4]
    uc008vzz.2, mouse [Q91V12-3]
    uc008waa.2, mouse [Q91V12-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		AB088411 mRNA Translation: BAC20217.1
    AB088412 mRNA Translation: BAC20218.1
    AB049821 mRNA Translation: BAB61731.1
    AB207243 mRNA Translation: BAD91166.1
    AK152277 mRNA Translation: BAE31092.1
    AL611985 Genomic DNA No translation available.
    AL671869 Genomic DNA No translation available.
    AL772240 Genomic DNA No translation available.
    BC013507 mRNA Translation: AAH13507.1
    CCDSiCCDS51390.1 [Q91V12-4]
    CCDS51391.2 [Q91V12-1]
    CCDS51392.1 [Q91V12-3]
    RefSeqiNP_001139529.1, NM_001146057.1 [Q91V12-1]
    NP_001139530.1, NM_001146058.1 [Q91V12-3]
    NP_579926.2, NM_133348.2 [Q91V12-4]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2Q2BX-ray2.50A/B203-381[»]
    2V1OX-ray1.78A/B/C/D/E/F59-206[»]
    4ZV3X-ray3.10A/B/C55-369[»]
    6VFYX-ray2.60D/E/F55-369[»]
    SMRiQ91V12
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi213825, 9 interactors
    DIPiDIP-54691N
    IntActiQ91V12, 4 interactors
    MINTiQ91V12
    STRINGi10090.ENSMUSP00000074827

    PTM databases

    iPTMnetiQ91V12
    PhosphoSitePlusiQ91V12
    SwissPalmiQ91V12

    2D gel databases

    REPRODUCTION-2DPAGEiQ91V12

    Proteomic databases

    PaxDbiQ91V12
    PeptideAtlasiQ91V12
    PRIDEiQ91V12

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		12967, 155 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		70025

    Genome annotation databases

    EnsembliENSMUST00000030779; ENSMUSP00000030779; ENSMUSG00000028937 [Q91V12-1]
    ENSMUST00000075363; ENSMUSP00000074827; ENSMUSG00000028937 [Q91V12-4]
    ENSMUST00000105652; ENSMUSP00000101277; ENSMUSG00000028937 [Q91V12-3]
    GeneIDi70025
    KEGGimmu:70025
    UCSCiuc008vzx.2, mouse [Q91V12-4]
    uc008vzz.2, mouse [Q91V12-3]
    uc008waa.2, mouse [Q91V12-2]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		11332
    MGIiMGI:1917275, Acot7

    Phylogenomic databases

    eggNOGiKOG2763, Eukaryota
    GeneTreeiENSGT00940000155229
    HOGENOMiCLU_050164_0_1_1
    InParanoidiQ91V12
    KOiK17360
    OMAiPTDVNWG
    OrthoDBi1069806at2759
    PhylomeDBiQ91V12
    TreeFamiTF329579

    Enzyme and pathway databases

    UniPathwayiUPA00199
    BRENDAi3.1.2.2, 3474
    ReactomeiR-MMU-77289, Mitochondrial Fatty Acid Beta-Oxidation
    SABIO-RKiQ91V12

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		70025, 0 hits in 18 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		Acot7, mouse
    EvolutionaryTraceiQ91V12

    Protein Ontology

    More...    PROi    		PR:Q91V12
    RNActiQ91V12, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSMUSG00000028937, Expressed in ventral horn of spinal cord and 344 other tissues
    ExpressionAtlasiQ91V12, baseline and differential
    GenevisibleiQ91V12, MM

    Family and domain databases

    InterProiView protein in InterPro
    IPR040170, Cytosol_ACT
    IPR033120, HOTDOG_ACOT
    IPR029069, HotDog_dom_sf
    IPR006683, Thioestr_dom
    PANTHERiPTHR11049, PTHR11049, 2 hits
    PfamiView protein in Pfam
    PF03061, 4HBT, 2 hits
    SUPFAMiSSF54637, SSF54637, 2 hits
    PROSITEiView protein in PROSITE
    PS51770, HOTDOG_ACOT, 2 hits

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBACH_MOUSE
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q91V12
    Secondary accession number(s): A2A8K9
    , A2A8L0, A2A8L2, Q3U8C6, Q59HQ2
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 12, 2003
    Last sequence update: February 12, 2003
    Last modified: August 12, 2020
    This is version 158 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again