Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (29 Sep 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Calcium-activated potassium channel subunit alpha-1

Gene

kcnma1

Organism
Xenopus laevis (African clawed frog)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX) (By similarity).

By similarity

Miscellaneous

The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel contains binding sites for Ca2+ and Mg2+.

Caution

It is uncertain whether Met-1 is the initiator or if the sequence starts further upstream.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi407MagnesiumBy similarity1
Metal bindingi430MagnesiumBy similarity1
Metal bindingi432MagnesiumBy similarity1
Metal bindingi923Calcium; via carbonyl oxygenBy similarity1
Metal bindingi926Calcium; via carbonyl oxygenBy similarity1
Metal bindingi929CalciumBy similarity1
Metal bindingi931CalciumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Magnesium, Metal-binding, Potassium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-activated potassium channel subunit alpha-1
Alternative name(s):
BK channel
BKCA alpha
Calcium-activated potassium channel, subfamily M subunit alpha-1
K(VCA)alpha
KCa1.1
Maxi K channel
Short name:
MaxiK
Slo-alpha
Slo1
Slowpoke homolog
Short name:
Slo homolog
Short name:
xSlo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:kcnma1
Synonyms:kcnma, xslo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiXenopus laevis (African clawed frog)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri8355 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiAmphibiaBatrachiaAnuraPipoideaPipidaeXenopodinaeXenopusXenopus

Organism-specific databases

Xenopus laevis and tropicalis biology and genomics resource

More...
Xenbasei
XB-GENE-922343, kcnma1.L

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 52ExtracellularSequence analysisAdd BLAST52
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei53 – 73Helical; Name=Segment S0Sequence analysisAdd BLAST21
Topological domaini74 – 146CytoplasmicSequence analysisAdd BLAST73
Transmembranei147 – 167Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini168 – 182ExtracellularSequence analysisAdd BLAST15
Transmembranei183 – 203Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini204 – 207CytoplasmicSequence analysis4
Transmembranei208 – 228Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini229 – 232ExtracellularSequence analysis4
Transmembranei233 – 253Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini254 – 268CytoplasmicSequence analysisAdd BLAST15
Transmembranei269 – 289Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini290 – 303ExtracellularSequence analysisAdd BLAST14
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei304 – 326Pore-forming; Name=P regionSequence analysisAdd BLAST23
Topological domaini327 – 335ExtracellularSequence analysis9
Transmembranei336 – 356Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini357 – 1196CytoplasmicSequence analysisAdd BLAST840

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000541391 – 1196Calcium-activated potassium channel subunit alpha-1Add BLAST1196

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in both the somites and neural tube of 1 day embryos. Within the nervous system, it is restricted to dorsal parts, and expressed centrally in regions dedicated to processing of sensory information. Six hours later, it is expressed segmentally within the somites. At this time, it is expressed in a primary sensory organ, the trigeminal ganglion. By 2 days, it is also expressed in other primary sensory organs, such as the otic vesicle, and the eye. Within the retina, it is expressed to an internal layer. In the developing otic vesicle, it is abundantly expressed near the apical surface. Isoform 3 is neural-specific, and is only expressed during late stages of neuronal differentiation.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed during embryogenesis before differentiation of excitable tissues.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer; which constitutes the calcium-activated potassium channel.

By similarity

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q90ZC7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini383 – 526RCK N-terminalAdd BLAST144

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni524 – 544Segment S7Add BLAST21
Regioni581 – 601Segment S8Add BLAST21
Regioni645 – 649Heme-binding motif5
Regioni672 – 697DisorderedSequence analysisAdd BLAST26
Regioni748 – 768Segment S9Add BLAST21
Regioni943 – 963Segment S10Add BLAST21
Regioni1098 – 1149DisorderedSequence analysisAdd BLAST52

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi320 – 323Selectivity for potassium4
Motifi914 – 936Calcium bowlAdd BLAST23

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1098 – 1128Polar residuesSequence analysisAdd BLAST31
Compositional biasi1129 – 1149Basic and acidic residuesSequence analysisAdd BLAST21

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The S0 segment is essential for the modulation by the accessory beta subunits.By similarity
The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor.By similarity
The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium (By similarity).By similarity
The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ (By similarity).By similarity
The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel (By similarity).By similarity
The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Database of Orthologous Groups

More...
OrthoDBi
124461at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024939, Ca-act_K_channel_Slo-1
IPR005821, Ion_trans_dom
IPR003929, K_chnl_BK_asu
IPR036291, NAD(P)-bd_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10027:SF28, PTHR10027:SF28, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03493, BK_channel_a, 1 hit
PF00520, Ion_trans, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735, SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q90ZC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATWNASQII LNSMSNIIES PQSKPRPVMA SNGASLFIPV TMEVPCDQGT
60 70 80 90 100
RMWWAFLASS MVTFFGGLFI ILVWRTFKYL WTVCCHCGGK NKEAQKVVNV
110 120 130 140 150
ASSQVTDGDY KPTDDKEEVG VAEVGWMTSV KDWAGVMISA QTLTGRVLVV
160 170 180 190 200
TVFALSIGAL MIYFIDSSNP IESCQNFYKD FTLQIDMAFN IFFLLYFGLR
210 220 230 240 250
FIAANDKLWF WLEVNSVVDF FTVPPVFVSV YLNRSWLGLR FLRALRLIQF
260 270 280 290 300
SEILQFLNIL KTSNSIKLVN LCSIFISTWL TAAGFIHLVE NSGDPWRNFE
310 320 330 340 350
NSQDLSYWEC MYLLMVTMST VGYGDVYAKT TLGRLFMVFF ILGGLAMFAS
360 370 380 390 400
YVPEIIELIG NRKKYGGSYS AVSGRKHIVV CGHITLESVS NFLKDFLHKD
410 420 430 440 450
RDDVNVEIVF LHNISPNLEL EALFKKHFTQ VEFYQGSVLN PHDLARVKIE
460 470 480 490 500
SADACLILAN KYCADPDAED ASNIMRVISI KNYHPKIRII TQMLQYHNKA
510 520 530 540 550
HLLNIPSWNW KDGDDAICLA ELKLGFIAQS CLAQGLSTML ANLFSMRSFI
560 570 580 590 600
KIEEDTWQKY YLEGVANEMY TEYLSSAFVG LSFPAVCELC FVKLKLLMIA
610 620 630 640 650
IEYKSEKGES RILINPGNHM KIKEGTLGFF IASDAKEVKR AFFYCKACHD
660 670 680 690 700
DITDPKRIKK CACKRLEDEQ PSALSPKKKQ RNGGMRHSPN TSPNMMRHDP
710 720 730 740 750
LLMTGNDQID NMDSSSVKRY DSTGMFHWCP AKELDKVLLT RSEAAMTVLS
760 770 780 790 800
GHVVVCIFGD MTSALIGVRN LVMPLRASNF HYHELKHIVF VGSLDYIKRE
810 820 830 840 850
WETLHNFPKV SILPGTPLSR ADLRAVNINL CDMCVILSAN QNNIDDTSLQ
860 870 880 890 900
DKECILASLN IKSMQFDDSI GLLQANSQGF TPPGMERSSP DNSPLHGVAR
910 920 930 940 950
QASITTGANI PIITELVNDS NVQFLDQDDD DDPDTELYLT QPFACGTAFA
960 970 980 990 1000
VSVLDSLMSA TYFNDNILTL IRTLVTGGAT PELEALVAEE NALRGGYSTP
1010 1020 1030 1040 1050
QTLANRDRCR VAQLALYDGP FADLGDGGCY GDLYCKALKT YNMLCFGIYR
1060 1070 1080 1090 1100
LRDAHISTPS QCTKRYVITN PPYEFELVPT DLIFCLMQFD HNASQSRASL
1110 1120 1130 1140 1150
SHSSHSSHSS SKKSSSVTSI LHTASANRQN RVKARDSRDK QKMGQAEKKW
1160 1170 1180 1190
YTDETENNYP RNIQIKPMST HMANQINQYK STSSLIPPIR EVEDEC
Length:1,196
Mass (Da):134,501
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAFA212532B571828
GO
Isoform 2 (identifier: Q90ZC7-2) [UniParc]FASTAAdd to basket
Also known as: xSlo15

The sequence of this isoform differs from the canonical sequence as follows:
     666-666: L → LLLTLPCLTALPVFAV

Show »
Length:1,211
Mass (Da):136,054
Checksum:i5474CCF8CBABE6BF
GO
Isoform 3 (identifier: Q90ZC7-3) [UniParc]FASTAAdd to basket
Also known as: xSlo56

The sequence of this isoform differs from the canonical sequence as follows:
     666-666: L → LIYSKMSIRKRLIQACCIGCSEIDCSCMSGTLRNNMGTLEQAFPISPVTVNDFSTSLRGF

Show »
Length:1,255
Mass (Da):140,979
Checksum:iD8FEA60D9E650B70
GO
Isoform 4 (identifier: Q90ZC7-4) [UniParc]FASTAAdd to basket
Also known as: xSlo59

The sequence of this isoform differs from the canonical sequence as follows:
     666-666: L → PKMSIRKRLIQACCIGCSEIDCSCMSGTLRNNMGTLEQAFPISPVTVNDFSTSLRGF

Show »
Length:1,252
Mass (Da):140,600
Checksum:i23D8C1554AC05439
GO
Isoform 5 (identifier: Q90ZC7-5) [UniParc]FASTAAdd to basket
Also known as: xSlo99

The sequence of this isoform differs from the canonical sequence as follows:
     666-666: L → PAKEEHRLSI...NQPILIQKQF

Show »
Length:1,295
Mass (Da):145,550
Checksum:iF452892E7D263B11
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009992666L → LLLTLPCLTALPVFAV in isoform 2. 1 Publication1
Alternative sequenceiVSP_009993666L → LIYSKMSIRKRLIQACCIGC SEIDCSCMSGTLRNNMGTLE QAFPISPVTVNDFSTSLRGF in isoform 3. 1 Publication1
Alternative sequenceiVSP_009994666L → PKMSIRKRLIQACCIGCSEI DCSCMSGTLRNNMGTLEQAF PISPVTVNDFSTSLRGF in isoform 4. 1 Publication1
Alternative sequenceiVSP_009995666L → PAKEEHRLSIHRLSIHSQAA KASYSVTSSKLCTEQQEPVP LVNNRKGSLFLPCDSSLLHL QLLSSSGTGHHTSIKLQRAL SLPGKYRYHPNQPILIQKQF in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF274053 mRNA Translation: AAK69394.1

NCBI Reference Sequences

More...
RefSeqi
NP_001079159.1, NM_001085690.1 [Q90ZC7-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
373712

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
xla:373712

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274053 mRNA Translation: AAK69394.1
RefSeqiNP_001079159.1, NM_001085690.1 [Q90ZC7-1]

3D structure databases

SMRiQ90ZC7
ModBaseiSearch...

Genome annotation databases

GeneIDi373712
KEGGixla:373712

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
373712
XenbaseiXB-GENE-922343, kcnma1.L

Phylogenomic databases

OrthoDBi124461at2759

Family and domain databases

InterProiView protein in InterPro
IPR024939, Ca-act_K_channel_Slo-1
IPR005821, Ion_trans_dom
IPR003929, K_chnl_BK_asu
IPR036291, NAD(P)-bd_dom_sf
PANTHERiPTHR10027:SF28, PTHR10027:SF28, 2 hits
PfamiView protein in Pfam
PF03493, BK_channel_a, 1 hit
PF00520, Ion_trans, 1 hit
SUPFAMiSSF51735, SSF51735, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCMA1_XENLA
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q90ZC7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: December 1, 2001
Last modified: September 29, 2021
This is version 106 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again