Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (07 Apr 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger CCHC domain-containing protein 14

Gene

ZCCHC14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri906 – 923CCHC-typePROSITE-ProRule annotationAdd BLAST18

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WYQ9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger CCHC domain-containing protein 14
Alternative name(s):
BDG-29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZCCHC14
Synonyms:KIAA0579
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24134, ZCCHC14

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WYQ9

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000140948.11

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23174

Open Targets

More...
OpenTargetsi
ENSG00000140948

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134895795

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WYQ9, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZCCHC14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
67462073

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001509751 – 949Zinc finger CCHC domain-containing protein 14Add BLAST949

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WYQ9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WYQ9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WYQ9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WYQ9

PeptideAtlas

More...
PeptideAtlasi
Q8WYQ9

PRoteomics IDEntifications database

More...
PRIDEi
Q8WYQ9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75192 [Q8WYQ9-1]
75193 [Q8WYQ9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WYQ9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WYQ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140948, Expressed in testis and 249 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WYQ9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WYQ9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000140948, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116786, 29 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WYQ9, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000268616

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WYQ9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WYQ9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi29 – 37Poly-Gly9
Compositional biasi420 – 425Poly-Ser6
Compositional biasi704 – 747Ser-richAdd BLAST44
Compositional biasi748 – 751Poly-Gly4
Compositional biasi763 – 769His-rich7
Compositional biasi772 – 783Poly-ProAdd BLAST12

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri906 – 923CCHC-typePROSITE-ProRule annotationAdd BLAST18

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3791, Eukaryota
KOG4400, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00520000055637

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014508_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WYQ9

Identification of Orthologs from Complete Genome Data

More...
OMAi
MVPPPLY

Database of Orthologous Groups

More...
OrthoDBi
200084at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WYQ9

TreeFam database of animal gene trees

More...
TreeFami
TF335574

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09558, SAM_ZCCH14, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.50, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036871, PX_dom_sf
IPR013761, SAM/pointed_sf
IPR037632, ZCCH14_SAM
IPR042344, ZCCHC14
IPR001878, Znf_CCHC
IPR036875, Znf_CCHC_sf

The PANTHER Classification System

More...
PANTHERi
PTHR16195, PTHR16195, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00098, zf-CCHC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00343, ZnF_C2HC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769, SSF47769, 1 hit
SSF57756, SSF57756, 1 hit
SSF64268, SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50158, ZF_CCHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WYQ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASNHPAFSF HQKQVLRQEL TQIQSSLNGG GGHGGKGAPG PGGALPTCPA
60 70 80 90 100
CHKITPRTEA PVSSVSNSLE NALHTSAHST EESLPKRPLG KHSKVSVEKI
110 120 130 140 150
DLKGLSHTKN DRNVECSFEV LWSDSSITSV TKSSSEVTEF ISKLCQLYPE
160 170 180 190 200
ENLEKLIPCL AGPDAFYVER NHVDLDSGLR YLASLPSHVL KNDHVRRFLS
210 220 230 240 250
TSSPPQQLQS PSPGNPSLSK VGTVMGVSGR PVCGVAGIPS SQSGAQHHGQ
260 270 280 290 300
HPAGSAAPLP HCSHAGSAGS ALAYRTQMDT SPAILMPSSL QTPQTQEQNG
310 320 330 340 350
ILDWLRKLRL HKYYPVFKQL SMEKFLSLTE EDLNKFESLT MGAKKKLKTQ
360 370 380 390 400
LELEKEKSER RCLNPSAPPL VTSSGVARVP PTSHVGPVQS GRGSHAAELR
410 420 430 440 450
VEVEQPHHQL PREGSSSEYS SSSSSPMGVQ AREESSDSAE ENDRRVEIHL
460 470 480 490 500
ESSDKEKPVM LLNHFTSSSA RPTAQVLPVQ NEASSNPSGH HPLPPQMLSA
510 520 530 540 550
ASHITPIRML NSVHKPERGS ADMKLLSSSV HSLLSLEERN KGSGPRSSMK
560 570 580 590 600
VDKSFGSAMM DVLPASAPHQ PVQVLSGLSE SSSMSPTVSF GPRTKVVHAS
610 620 630 640 650
TLDRVLKTAQ QPALVVETST AATGTPSTVL HAARPPIKLL LSSSVPADSA
660 670 680 690 700
ISGQTSCPNN VQISVPPAII NPRTALYTAN TKVAFSAMSS MPVGPLQGGF
710 720 730 740 750
CANSNTASPS SHPSTSFANM ATLPSCPAPS SSPALSSVPE SSFYSSSGGG
760 770 780 790 800
GSTGNIPASN PNHHHHHHHQ QPPAPPQPAP PPPGCIVCTS CGCSGSCGSS
810 820 830 840 850
GLTVSYANYF QHPFSGPSVF TFPFLPFSPM CSSGYVSAQQ YGGGSTFPVV
860 870 880 890 900
HAPYSSSGTP DPVLSGQSTF AVPPMQNFMA GTAGVYQTQG LVGSSNGSSH
910 920 930 940
KKSGNLSCYN CGATGHRAQD CKQPSMDFNR PGTFRLKYAP PAESLDSTD
Length:949
Mass (Da):100,042
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6770937387359D14
GO
Isoform 2 (identifier: Q8WYQ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     933-949: TFRLKYAPPAESLDSTD → KRAPWPRPPGSRRTSAHKCLVFMKSKLLSL

Show »
Length:962
Mass (Da):101,580
Checksum:iDC7CF77DAC104B06
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BS18H3BS18_HUMAN
Zinc finger CCHC domain-containing ...
ZCCHC14
846Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9XIK1A0A5F9XIK1_HUMAN
Zinc finger CCHC domain-containing ...
ZCCHC14
960Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UJW6A0A590UJW6_HUMAN
Zinc finger CCHC domain-containing ...
ZCCHC14
1,086Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05375454I → V. Corresponds to variant dbSNP:rs11648852Ensembl.1
Natural variantiVAR_053755244G → A. Corresponds to variant dbSNP:rs13338940Ensembl.1
Natural variantiVAR_036492290L → V in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_024703693V → M1 PublicationCorresponds to variant dbSNP:rs3748400Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013843933 – 949TFRLK…LDSTD → KRAPWPRPPGSRRTSAHKCL VFMKSKLLSL in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB030243 mRNA Translation: BAB83129.1
CH471114 Genomic DNA Translation: EAW95389.1
CH471114 Genomic DNA Translation: EAW95390.1
BC101478 mRNA Translation: AAI01479.1
AB011151 mRNA Translation: BAA25505.2
AL117532 mRNA Translation: CAB55981.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T17291

NCBI Reference Sequences

More...
RefSeqi
NP_055959.1, NM_015144.2
XP_005255915.2, XM_005255858.3 [Q8WYQ9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268616; ENSP00000268616; ENSG00000140948 [Q8WYQ9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23174

UCSC genome browser

More...
UCSCi
uc002fjz.2, human [Q8WYQ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030243 mRNA Translation: BAB83129.1
CH471114 Genomic DNA Translation: EAW95389.1
CH471114 Genomic DNA Translation: EAW95390.1
BC101478 mRNA Translation: AAI01479.1
AB011151 mRNA Translation: BAA25505.2
AL117532 mRNA Translation: CAB55981.1
PIRiT17291
RefSeqiNP_055959.1, NM_015144.2
XP_005255915.2, XM_005255858.3 [Q8WYQ9-2]

3D structure databases

SMRiQ8WYQ9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116786, 29 interactors
IntActiQ8WYQ9, 10 interactors
STRINGi9606.ENSP00000268616

PTM databases

iPTMnetiQ8WYQ9
PhosphoSitePlusiQ8WYQ9

Genetic variation databases

BioMutaiZCCHC14
DMDMi67462073

Proteomic databases

EPDiQ8WYQ9
MassIVEiQ8WYQ9
MaxQBiQ8WYQ9
PaxDbiQ8WYQ9
PeptideAtlasiQ8WYQ9
PRIDEiQ8WYQ9
ProteomicsDBi75192 [Q8WYQ9-1]
75193 [Q8WYQ9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2893, 66 antibodies

Genome annotation databases

EnsembliENST00000268616; ENSP00000268616; ENSG00000140948 [Q8WYQ9-1]
GeneIDi23174
KEGGihsa:23174
UCSCiuc002fjz.2, human [Q8WYQ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23174
DisGeNETi23174

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZCCHC14
HGNCiHGNC:24134, ZCCHC14
HPAiENSG00000140948, Low tissue specificity
neXtProtiNX_Q8WYQ9
OpenTargetsiENSG00000140948
PharmGKBiPA134895795
VEuPathDBiHostDB:ENSG00000140948.11

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3791, Eukaryota
KOG4400, Eukaryota
GeneTreeiENSGT00520000055637
HOGENOMiCLU_014508_0_0_1
InParanoidiQ8WYQ9
OMAiMVPPPLY
OrthoDBi200084at2759
PhylomeDBiQ8WYQ9
TreeFamiTF335574

Enzyme and pathway databases

PathwayCommonsiQ8WYQ9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23174, 22 hits in 1002 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZCCHC14, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23174
PharosiQ8WYQ9, Tdark

Protein Ontology

More...
PROi
PR:Q8WYQ9
RNActiQ8WYQ9, protein

Gene expression databases

BgeeiENSG00000140948, Expressed in testis and 249 other tissues
ExpressionAtlasiQ8WYQ9, baseline and differential
GenevisibleiQ8WYQ9, HS

Family and domain databases

CDDicd09558, SAM_ZCCH14, 1 hit
Gene3Di1.10.150.50, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR036871, PX_dom_sf
IPR013761, SAM/pointed_sf
IPR037632, ZCCH14_SAM
IPR042344, ZCCHC14
IPR001878, Znf_CCHC
IPR036875, Znf_CCHC_sf
PANTHERiPTHR16195, PTHR16195, 1 hit
PfamiView protein in Pfam
PF00098, zf-CCHC, 1 hit
SMARTiView protein in SMART
SM00343, ZnF_C2HC, 1 hit
SUPFAMiSSF47769, SSF47769, 1 hit
SSF57756, SSF57756, 1 hit
SSF64268, SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50158, ZF_CCHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZCH14_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WYQ9
Secondary accession number(s): D3DUN1
, O60324, Q3MJD8, Q9UFP0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2002
Last modified: April 7, 2021
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again