Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (12 Aug 2020)
Sequence version 3 (24 May 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

VPS10 domain-containing receptor SorCS1

Gene

SORCS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WY21

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.63.1.5, the retromer-dependent vacuolar protein sorting (r-vps) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
VPS10 domain-containing receptor SorCS1
Short name:
hSorCS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SORCS1
Synonyms:SORCS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000108018.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16697, SORCS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606283, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WY21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini34 – 1099LumenalSequence analysisAdd BLAST1066
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1100 – 1120HelicalSequence analysisAdd BLAST21
Topological domaini1121 – 1168CytoplasmicSequence analysisAdd BLAST48

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
114815

Open Targets

More...
OpenTargetsi
ENSG00000108018

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134861284

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WY21, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SORCS1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
66774216

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 33Sequence analysisAdd BLAST33
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003317034 – 1168VPS10 domain-containing receptor SorCS1Add BLAST1135

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi68O-linked (GalNAc...) threonine1 Publication1
Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi352N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi433N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi765N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi776N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi816N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi847N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi908N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi929N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WY21

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WY21

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WY21

PeptideAtlas

More...
PeptideAtlasi
Q8WY21

PRoteomics IDEntifications database

More...
PRIDEi
Q8WY21

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75119 [Q8WY21-1]
75120 [Q8WY21-2]
75121 [Q8WY21-3]
75122 [Q8WY21-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8WY21-3 [Q8WY21-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8WY21, 10 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WY21

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WY21

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in fetal and infant brain and in fetal retina.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108018, Expressed in cortical plate and 147 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WY21, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WY21, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000108018, Tissue enhanced (thyroid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
125367, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WY21, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263054

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WY21, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WY21

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati208 – 219BNR 1Add BLAST12
Repeati256 – 267BNR 2Add BLAST12
Repeati492 – 503BNR 3Add BLAST12
Repeati569 – 580BNR 4Add BLAST12
Repeati611 – 622BNR 5Add BLAST12
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini803 – 894PKDPROSITE-ProRule annotationAdd BLAST92

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3511, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00990000203581

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WY21

Identification of Orthologs from Complete Genome Data

More...
OMAi
RTDGKCT

Database of Orthologous Groups

More...
OrthoDBi
1046610at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WY21

TreeFam database of animal gene trees

More...
TreeFami
TF324918

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783, Ig-like_fold
IPR000601, PKD_dom
IPR035986, PKD_dom_sf
IPR031777, Sortilin_C
IPR031778, Sortilin_N
IPR006581, VPS10
IPR015943, WD40/YVTN_repeat-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00801, PKD, 1 hit
PF15902, Sortilin-Vps10, 1 hit
PF15901, Sortilin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00602, VPS10, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49299, SSF49299, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50093, PKD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WY21-1) [UniParc]FASTAAdd to basket
Also known as: B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKVGAGGGS QARLSALLAG AGLLILCAPG VCGGGSCCPS PHPSSAPRSA
60 70 80 90 100
STPRGFSHQG RPGRAPATPL PLVVRPLFSV APGDRALSLE RARGTGASMA
110 120 130 140 150
VAARSGRRRR SGADQEKAER GEGASRSPRG VLRDGGQQEP GTRERDPDKA
160 170 180 190 200
TRFRMEELRL TSTTFALTGD SAHNQAMVHW SGHNSSVILI LTKLYDYNLG
210 220 230 240 250
SITESSLWRS TDYGTTYEKL NDKVGLKTIL SYLYVCPTNK RKIMLLTDPE
260 270 280 290 300
IESSLLISSD EGATYQKYRL NFYIQSLLFH PKQEDWILAY SQDQKLYSSA
310 320 330 340 350
EFGRRWQLIQ EGVVPNRFYW SVMGSNKEPD LVHLEARTVD GHSHYLTCRM
360 370 380 390 400
QNCTEANRNQ PFPGYIDPDS LIVQDHYVFV QLTSGGRPHY YVSYRRNAFA
410 420 430 440 450
QMKLPKYALP KDMHVISTDE NQVFAAVQEW NQNDTYNLYI SDTRGVYFTL
460 470 480 490 500
ALENVQSSRG PEGNIMIDLY EVAGIKGMFL ANKKIDNQVK TFITYNKGRD
510 520 530 540 550
WRLLQAPDTD LRGDPVHCLL PYCSLHLHLK VSENPYTSGI IASKDTAPSI
560 570 580 590 600
IVASGNIGSE LSDTDISMFV SSDAGNTWRQ IFEEEHSVLY LDQGGVLVAM
610 620 630 640 650
KHTSLPIRHL WLSFDEGRSW SKYSFTSIPL FVDGVLGEPG EETLIMTVFG
660 670 680 690 700
HFSHRSEWQL VKVDYKSIFD RRCAEEDYRP WQLHSQGEAC IMGAKRIYKK
710 720 730 740 750
RKSERKCMQG KYAGAMESEP CVCTEADFDC DYGYERHSNG QCLPAFWFNP
760 770 780 790 800
SSLSKDCSLG QSYLNSTGYR KVVSNNCTDG VREQYTAKPQ KCPGKAPRGL
810 820 830 840 850
RIVTADGKLT AEQGHNVTLM VQLEEGDVQR TLIQVDFGDG IAVSYVNLSS
860 870 880 890 900
MEDGIKHVYQ NVGIFRVTVQ VDNSLGSDSA VLYLHVTCPL EHVHLSLPFV
910 920 930 940 950
TTKNKEVNAT AVLWPSQVGT LTYVWWYGNN TEPLITLEGS ISFRFTSEGM
960 970 980 990 1000
NTITVQVSAG NAILQDTKTI AVYEEFRSLR LSFSPNLDDY NPDIPEWRRD
1010 1020 1030 1040 1050
IGRVIKKSLV EATGVPGQHI LVAVLPGLPT TAELFVLPYQ DPAGENKRST
1060 1070 1080 1090 1100
DDLEQISELL IHTLNQNSVH FELKPGVRVL VHAAHLTAAP LVDLTPTHSG
1110 1120 1130 1140 1150
SAMLMLLSVV FVGLAVFVIY KFKRRVALPS PPSPSTQPGD SSLRLQRARH
1160
ATPPSTPKRG SAGAQYAI
Length:1,168
Mass (Da):129,635
Last modified:May 24, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBAF8D4FB87A4F998
GO
Isoform 2 (identifier: Q8WY21-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → KIPGINVYAQ...TKEIPTYVNV

Show »
Length:1,198
Mass (Da):133,373
Checksum:i1B7EE3F03DC9CDE0
GO
Isoform 3 (identifier: Q8WY21-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → KIPGINVYAQ...EKVESQLIGK

Show »
Length:1,179
Mass (Da):131,327
Checksum:i0C2E5DACD6A47209
GO
Isoform 4 (identifier: Q8WY21-4) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → CVSLYPRSPTPDLFLLPDRFRSMCYSDVHSSDGFY

Show »
Length:1,159
Mass (Da):129,141
Checksum:i46135ADD8F627AAE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTQ9A0A087WTQ9_HUMAN
VPS10 domain-containing receptor So...
SORCS1
937Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6R7D6X6R7D6_HUMAN
VPS10 domain-containing receptor So...
SORCS1
714Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRC2A0A0A0MRC2_HUMAN
VPS10 domain-containing receptor So...
SORCS1
945Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTI0A0A087WTI0_HUMAN
VPS10 domain-containing receptor So...
SORCS1
926Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2U3H7C2U3_HUMAN
VPS10 domain-containing receptor So...
SORCS1
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92379 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti231S → G in AAL56667 (PubMed:12482870).Curated1
Sequence conflicti487N → Y in AAL56667 (PubMed:12482870).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036374223K → N in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0062041125 – 1168RVALP…AQYAI → KIPGINVYAQMQNEKEQEMI SPVSHSESRPNVPQTELRRP GQLIDEKVESQLIGSISIVA ENQSTKEIPTYVNV in isoform 2. CuratedAdd BLAST44
Alternative sequenceiVSP_0151401125 – 1168RVALP…AQYAI → KIPGINVYAQMQNEKEQEMI SPVSHSESRPNVPQTELRRP GQLIDEKVESQLIGK in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0151411125 – 1168RVALP…AQYAI → CVSLYPRSPTPDLFLLPDRF RSMCYSDVHSSDGFY in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF284756 mRNA Translation: AAL56667.1
AY099452 mRNA Translation: AAM43811.1
AY099453 mRNA Translation: AAM43812.1
AB209142 mRNA Translation: BAD92379.1 Different initiation.
AL133395 Genomic DNA No translation available.
AL160010 Genomic DNA No translation available.
AL356255 Genomic DNA No translation available.
AL356308 Genomic DNA No translation available.
AL357333 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49583.1
BC131597 mRNA Translation: AAI31598.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7559.1 [Q8WY21-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001013049.1, NM_001013031.2 [Q8WY21-2]
NP_001193498.1, NM_001206569.1 [Q8WY21-3]
NP_001193499.1, NM_001206570.1
NP_001193500.1, NM_001206571.1 [Q8WY21-4]
NP_001193501.1, NM_001206572.1
NP_443150.3, NM_052918.4 [Q8WY21-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263054; ENSP00000263054; ENSG00000108018 [Q8WY21-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
114815

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:114815

UCSC genome browser

More...
UCSCi
uc001kym.4, human [Q8WY21-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF284756 mRNA Translation: AAL56667.1
AY099452 mRNA Translation: AAM43811.1
AY099453 mRNA Translation: AAM43812.1
AB209142 mRNA Translation: BAD92379.1 Different initiation.
AL133395 Genomic DNA No translation available.
AL160010 Genomic DNA No translation available.
AL356255 Genomic DNA No translation available.
AL356308 Genomic DNA No translation available.
AL357333 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49583.1
BC131597 mRNA Translation: AAI31598.1
CCDSiCCDS7559.1 [Q8WY21-1]
RefSeqiNP_001013049.1, NM_001013031.2 [Q8WY21-2]
NP_001193498.1, NM_001206569.1 [Q8WY21-3]
NP_001193499.1, NM_001206570.1
NP_001193500.1, NM_001206571.1 [Q8WY21-4]
NP_001193501.1, NM_001206572.1
NP_443150.3, NM_052918.4 [Q8WY21-1]

3D structure databases

SMRiQ8WY21
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi125367, 2 interactors
IntActiQ8WY21, 2 interactors
STRINGi9606.ENSP00000263054

Protein family/group databases

TCDBi9.A.63.1.5, the retromer-dependent vacuolar protein sorting (r-vps) family

PTM databases

GlyGeniQ8WY21, 10 sites
iPTMnetiQ8WY21
PhosphoSitePlusiQ8WY21

Polymorphism and mutation databases

BioMutaiSORCS1
DMDMi66774216

Proteomic databases

jPOSTiQ8WY21
MassIVEiQ8WY21
PaxDbiQ8WY21
PeptideAtlasiQ8WY21
PRIDEiQ8WY21
ProteomicsDBi75119 [Q8WY21-1]
75120 [Q8WY21-2]
75121 [Q8WY21-3]
75122 [Q8WY21-4]
TopDownProteomicsiQ8WY21-3 [Q8WY21-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2334, 115 antibodies

Genome annotation databases

EnsembliENST00000263054; ENSP00000263054; ENSG00000108018 [Q8WY21-1]
GeneIDi114815
KEGGihsa:114815
UCSCiuc001kym.4, human [Q8WY21-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114815
DisGeNETi114815
EuPathDBiHostDB:ENSG00000108018.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SORCS1
HGNCiHGNC:16697, SORCS1
HPAiENSG00000108018, Tissue enhanced (thyroid)
MIMi606283, gene
neXtProtiNX_Q8WY21
OpenTargetsiENSG00000108018
PharmGKBiPA134861284

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3511, Eukaryota
GeneTreeiENSGT00990000203581
InParanoidiQ8WY21
OMAiRTDGKCT
OrthoDBi1046610at2759
PhylomeDBiQ8WY21
TreeFamiTF324918

Enzyme and pathway databases

PathwayCommonsiQ8WY21

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
114815, 2 hits in 870 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SORCS1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
114815
PharosiQ8WY21, Tbio

Protein Ontology

More...
PROi
PR:Q8WY21
RNActiQ8WY21, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108018, Expressed in cortical plate and 147 other tissues
ExpressionAtlasiQ8WY21, baseline and differential
GenevisibleiQ8WY21, HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013783, Ig-like_fold
IPR000601, PKD_dom
IPR035986, PKD_dom_sf
IPR031777, Sortilin_C
IPR031778, Sortilin_N
IPR006581, VPS10
IPR015943, WD40/YVTN_repeat-like_dom_sf
PfamiView protein in Pfam
PF00801, PKD, 1 hit
PF15902, Sortilin-Vps10, 1 hit
PF15901, Sortilin_C, 1 hit
SMARTiView protein in SMART
SM00602, VPS10, 1 hit
SUPFAMiSSF49299, SSF49299, 2 hits
PROSITEiView protein in PROSITE
PS50093, PKD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSORC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WY21
Secondary accession number(s): A2RRF4
, Q59GG7, Q5JVT7, Q5JVT8, Q5VY14, Q86WQ1, Q86WQ2, Q9H1Y1, Q9H1Y2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: May 24, 2005
Last modified: August 12, 2020
This is version 155 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again