Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (07 Oct 2020)
Sequence version 4 (07 Oct 2020)
Previous versions | rss
Add a publicationFeedback
Protein

Brain and acute leukemia cytoplasmic protein

Gene

BAALC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a synaptic role at the postsynaptic lipid rafts possibly through interaction with CAMK2A.By similarity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WXS3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8WXS3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Brain and acute leukemia cytoplasmic protein1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BAALC1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164929.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14333, BAALC

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606602, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WXS3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79870

Open Targets

More...
OpenTargetsi
ENSG00000164929

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25230

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WXS3, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BAALC

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730996

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002482052 – 145Brain and acute leukemia cytoplasmic proteinAdd BLAST144

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
Lipidationi3S-palmitoyl cysteineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylation and myristoylation target the protein to the lipid rafts.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WXS3

PeptideAtlas

More...
PeptideAtlasi
Q8WXS3

PRoteomics IDEntifications database

More...
PRIDEi
Q8WXS3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75088 [Q8WXS3-1]
75089 [Q8WXS3-2]
75090 [Q8WXS3-3]
75091 [Q8WXS3-4]
75092 [Q8WXS3-5]
75093 [Q8WXS3-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WXS3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WXS3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in neuroectoderm-derived tissues. Expressed in the brain and spinal cord, and at low levels, in the adrenal gland. In the bone marrow, confined to the CD34+ progenitor cells. Not found in peripheral blood mononuclear cells, nor lymph nodes. Tends to be expressed at high levels in acute myeloid leukemia and glioblastoma cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164929, Expressed in hypothalamus and 163 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WXS3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000164929, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CAMK2A.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122958, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WXS3, 6 interactors

Molecular INTeraction database

More...
MINTi
Q8WXS3

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WXS3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WXS3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni3 – 35Interaction with CAMK2ABy similarityAdd BLAST33

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013853

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_135096_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WXS3

Identification of Orthologs from Complete Genome Data

More...
OMAi
QAYLKVC

Database of Orthologous Groups

More...
OrthoDBi
1437892at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WXS3

TreeFam database of animal gene trees

More...
TreeFami
TF330767

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009728, BAALC

The PANTHER Classification System

More...
PANTHERi
PTHR14731, PTHR14731, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06989, BAALC_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8WXS3-2) [UniParc]FASTAAdd to basket
Also known as: 1-6-81 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCGGSRADA IEPRYYESWT RETESTWLTY TDSDAPPSAA APDSGPEAGG
60 70 80 90 100
LHSGMLEDGL PSNGVPRSTA PGGIPNPEKK TNCETQCPNP QSLSSGPLTQ
110 120 130 140
KQNGLQTTEA KRDAKRMPAK EVTINVTDSI QQMDRSRRIT KNCVN
Length:145
Mass (Da):15,551
Last modified:October 7, 2020 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCFB92BBE283DD92E
GO
Isoform 2 (identifier: Q8WXS3-1) [UniParc]FASTAAdd to basket
Also known as: 1-5-6-81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: S → SVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFSH

Show »
Length:180
Mass (Da):19,224
Checksum:i380183E0F188F684
GO
Isoform 3 (identifier: Q8WXS3-3) [UniParc]FASTAAdd to basket
Also known as: 1-5-6-7-81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: S → SVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFSH
     110-114: AKRDA → VLLPS
     115-145: Missing.

Show »
Length:149
Mass (Da):15,577
Checksum:iDB26C19969B91F6E
GO
Isoform 4 (identifier: Q8WXS3-4) [UniParc]FASTAAdd to basket
Also known as: 1-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     54-80: GMLEDGLPSNGVPRSTAPGGIPNPEKK → AHYPLAFALAWRDNSLGALLVQEGLCR
     81-145: Missing.

Show »
Length:80
Mass (Da):8,573
Checksum:i70BE9B91C3245E2D
GO
Isoform 5 (identifier: Q8WXS3-5) [UniParc]FASTAAdd to basket
Also known as: 1-4-5-6-81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     55-73: MLEDGLPSNGVPRSTAPGG → CLEEHYHLTALQKVGHPNH
     74-145: Missing.

Show »
Length:73
Mass (Da):7,871
Checksum:i98DBC2E6E6EF524A
GO
Isoform 6 (identifier: Q8WXS3-6) [UniParc]FASTAAdd to basket
Also known as: 1-81 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     55-145: Missing.

Show »
Length:54
Mass (Da):5,663
Checksum:iFEF0B4EABED9B829
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056741129S → T. Corresponds to variant dbSNP:rs34542607Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_06071253S → SVLEAEKSKIKAPTDSVSDE GLFSASKMAPLAVFSH in isoform 2 and isoform 3. 1 Publication1
Alternative sequenceiVSP_06071354 – 80GMLED…NPEKK → AHYPLAFALAWRDNSLGALL VQEGLCR in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_06071455 – 145Missing in isoform 6. 1 PublicationAdd BLAST91
Alternative sequenceiVSP_06071555 – 73MLEDG…TAPGG → CLEEHYHLTALQKVGHPNH in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_06071674 – 145Missing in isoform 5. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_06071781 – 145Missing in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_060718110 – 114AKRDA → VLLPS in isoform 3. 1 Publication5
Alternative sequenceiVSP_060719115 – 145Missing in isoform 3. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF371319 mRNA Translation: AAL50515.1
AF371323 mRNA Translation: AAL50519.1
AF363578 Genomic DNA Translation: AAL50377.1
AF363578 Genomic DNA Translation: AAL50378.1
AF363578 Genomic DNA Translation: AAL50379.1
AF363578 Genomic DNA Translation: AAL50380.1
AF363578 Genomic DNA Translation: AAL50381.1
AF363578 Genomic DNA Translation: AAL50382.1
AK022077 mRNA Translation: BAB13960.1
BC011517 mRNA Translation: AAH11517.1
BC035038 mRNA Translation: AAH35038.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47906.1 [Q8WXS3-6]
CCDS6297.1 [Q8WXS3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001019543.1, NM_001024372.1 [Q8WXS3-6]
NP_079088.1, NM_024812.2 [Q8WXS3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297574; ENSP00000297574; ENSG00000164929 [Q8WXS3-1]
ENST00000306391; ENSP00000302559; ENSG00000164929 [Q8WXS3-4]
ENST00000309982; ENSP00000312457; ENSG00000164929 [Q8WXS3-2]
ENST00000330955; ENSP00000331579; ENSG00000164929 [Q8WXS3-5]
ENST00000438105; ENSP00000395024; ENSG00000164929 [Q8WXS3-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79870

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79870

UCSC genome browser

More...
UCSCi
uc003yld.4, human [Q8WXS3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371319 mRNA Translation: AAL50515.1
AF371323 mRNA Translation: AAL50519.1
AF363578 Genomic DNA Translation: AAL50377.1
AF363578 Genomic DNA Translation: AAL50378.1
AF363578 Genomic DNA Translation: AAL50379.1
AF363578 Genomic DNA Translation: AAL50380.1
AF363578 Genomic DNA Translation: AAL50381.1
AF363578 Genomic DNA Translation: AAL50382.1
AK022077 mRNA Translation: BAB13960.1
BC011517 mRNA Translation: AAH11517.1
BC035038 mRNA Translation: AAH35038.1
CCDSiCCDS47906.1 [Q8WXS3-6]
CCDS6297.1 [Q8WXS3-2]
RefSeqiNP_001019543.1, NM_001024372.1 [Q8WXS3-6]
NP_079088.1, NM_024812.2 [Q8WXS3-2]

3D structure databases

SMRiQ8WXS3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122958, 13 interactors
IntActiQ8WXS3, 6 interactors
MINTiQ8WXS3

PTM databases

iPTMnetiQ8WXS3
PhosphoSitePlusiQ8WXS3

Polymorphism and mutation databases

BioMutaiBAALC
DMDMi74730996

Proteomic databases

MassIVEiQ8WXS3
PeptideAtlasiQ8WXS3
PRIDEiQ8WXS3
ProteomicsDBi75088 [Q8WXS3-1]
75089 [Q8WXS3-2]
75090 [Q8WXS3-3]
75091 [Q8WXS3-4]
75092 [Q8WXS3-5]
75093 [Q8WXS3-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26359, 145 antibodies

The DNASU plasmid repository

More...
DNASUi
79870

Genome annotation databases

EnsembliENST00000297574; ENSP00000297574; ENSG00000164929 [Q8WXS3-1]
ENST00000306391; ENSP00000302559; ENSG00000164929 [Q8WXS3-4]
ENST00000309982; ENSP00000312457; ENSG00000164929 [Q8WXS3-2]
ENST00000330955; ENSP00000331579; ENSG00000164929 [Q8WXS3-5]
ENST00000438105; ENSP00000395024; ENSG00000164929 [Q8WXS3-6]
GeneIDi79870
KEGGihsa:79870
UCSCiuc003yld.4, human [Q8WXS3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79870
DisGeNETi79870
EuPathDBiHostDB:ENSG00000164929.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BAALC
HGNCiHGNC:14333, BAALC
HPAiENSG00000164929, Tissue enriched (brain)
MIMi606602, gene
neXtProtiNX_Q8WXS3
OpenTargetsiENSG00000164929
PharmGKBiPA25230

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000013853
HOGENOMiCLU_135096_0_0_1
InParanoidiQ8WXS3
OMAiQAYLKVC
OrthoDBi1437892at2759
PhylomeDBiQ8WXS3
TreeFamiTF330767

Enzyme and pathway databases

PathwayCommonsiQ8WXS3
SIGNORiQ8WXS3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79870, 1 hit in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BAALC, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79870
PharosiQ8WXS3, Tbio

Protein Ontology

More...
PROi
PR:Q8WXS3
RNActiQ8WXS3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164929, Expressed in hypothalamus and 163 other tissues
GenevisibleiQ8WXS3, HS

Family and domain databases

InterProiView protein in InterPro
IPR009728, BAALC
PANTHERiPTHR14731, PTHR14731, 1 hit
PfamiView protein in Pfam
PF06989, BAALC_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAALC_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WXS3
Secondary accession number(s): Q8WTP6
, Q8WXS0, Q8WXS1, Q8WXS2, Q9HA93
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: October 7, 2020
Last modified: October 7, 2020
This is version 122 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again