Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin-IIIb

Gene

MYO3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable actin-based motor with a protein kinase activity. Required for normal cochlear hair bundle development and hearing. Plays an important role in the early steps of cochlear hair bundle morphogenesis. Influences the number and lengths of stereocilia to be produced and limits the growth of microvilli within the forming auditory hair bundles thereby contributing to the architecture of the hair bundle, including its staircase pattern. Involved in the elongation of actin in stereocilia tips by transporting the actin regulatory factor ESPN to the plus ends of actin filaments.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei56ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei156Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi33 – 41ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Kinase, Motor protein, Myosin, Serine/threonine-protein kinase, Transferase
Biological processHearing, Sensory transduction, Vision
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8WXR4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myosin-IIIb (EC:2.7.11.1)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYO3B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000071909.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15576 MYO3B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610040 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WXR4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
140469

Open Targets

More...
OpenTargetsi
ENSG00000071909

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31406

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5654

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYO3B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439486

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000864151 – 1341Myosin-IIIbAdd BLAST1341

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WXR4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WXR4

PeptideAtlas

More...
PeptideAtlasi
Q8WXR4

PRoteomics IDEntifications database

More...
PRIDEi
Q8WXR4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75080
75081 [Q8WXR4-2]
75082 [Q8WXR4-3]
75083 [Q8WXR4-4]
75084 [Q8WXR4-5]
75085 [Q8WXR4-6]
75086 [Q8WXR4-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WXR4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WXR4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in retina, kidney and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000071909 Expressed in 57 organ(s), highest expression level in caput epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WXR4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WXR4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045483

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with ESPN. Interacts (via C-terminus) with ESPNL.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126621, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WXR4, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000386213

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8WXR4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8WXR4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WXR4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 293Protein kinasePROSITE-ProRule annotationAdd BLAST267
Domaini343 – 1058Myosin motorPROSITE-ProRule annotationAdd BLAST716
Domaini1060 – 1089IQ 1PROSITE-ProRule annotationAdd BLAST30
Domaini1087 – 1116IQ 2PROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni939 – 961Actin-bindingPROSITE-ProRule annotationAdd BLAST23

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the C-terminal section; belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.Curated
In the N-terminal section; belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0587 Eukaryota
KOG4229 Eukaryota
COG5022 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159309

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052555

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WXR4

KEGG Orthology (KO)

More...
KOi
K08834

Identification of Orthologs from Complete Genome Data

More...
OMAi
RPYHVED

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00C2

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WXR4

TreeFam database of animal gene trees

More...
TreeFami
TF326512

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01379 MYSc_Myo3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR011009 Kinase-like_dom_sf
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR036083 MYSc_Myo3
IPR027417 P-loop_NTPase
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00612 IQ, 1 hit
PF00063 Myosin_head, 1 hit
PF00069 Pkinase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00193 MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00015 IQ, 2 hits
SM00242 MYSc, 1 hit
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096 IQ, 2 hits
PS51456 MYOSIN_MOTOR, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WXR4-1) [UniParc]FASTAAdd to basket
Also known as: MYO3B.2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKHLYGLFHY NPMMLGLESL PDPTDTWEII ETIGKGTYGK VYKVTNKRDG
60 70 80 90 100
SLAAVKILDP VSDMDEEIEA EYNILQFLPN HPNVVKFYGM FYKADHCVGG
110 120 130 140 150
QLWLVLELCN GGSVTELVKG LLRCGQRLDE AMISYILYGA LLGLQHLHNN
160 170 180 190 200
RIIHRDVKGN NILLTTEGGV KLVDFGVSAQ LTSTRLRRNT SVGTPFWMAP
210 220 230 240 250
EVIACEQQYD SSYDARCDVW SLGITAIELG DGDPPLFDMH PVKTLFKIPR
260 270 280 290 300
NPPPTLLHPE KWCEEFNHFI SQCLIKDFER RPSVTHLLDH PFIKGVHGKV
310 320 330 340 350
LFLQKQLAKV LQDQKHQNPV AKTRHERMHT RRPYHVEDAE KYCLEDDLVN
360 370 380 390 400
LEVLDEDTII HQLQKRYADL LIYTYVGDIL IALNPFQNLS IYSPQFSRLY
410 420 430 440 450
HGVKRASNPP HIFASADAAY QCMVTLSKDQ CIVISGESGS GKTESAHLIV
460 470 480 490 500
QHLTFLGKAN NQTLREKILQ VNSLVEAFGN SCTAINDNSS RFGKYLEMMF
510 520 530 540 550
TPTGVVMGAR ISEYLLEKSR VIKQAAREKN FHIFYYIYAG LHHQKKLSDF
560 570 580 590 600
RLPEEKPPRY IADETGRVMH DITSKESYRR QFEAIQHCFR IIGFTDKEVH
610 620 630 640 650
SVYRILAGIL NIGNIEFAAI SSQHQTDKSE VPNAEALQNA ASVLCISPEE
660 670 680 690 700
LQEALTSHCV VTRGETIIRA NTVDRAADVR DAMSKALYGR LFSWIVNRIN
710 720 730 740 750
TLLQPDENIC SAGGGMNVGI LDIFGFENFQ RNSFEQLCIN IANEQIQYYF
760 770 780 790 800
NQHVFALEQM EYQNEGIDAV PVEYEDNRPL LDMFLQKPLG LLALLDEESR
810 820 830 840 850
FPQATDQTLV DKFEDNLRCK YFWRPKGVEL CFGIQHYAGK VLYDASGVLE
860 870 880 890 900
KNRDTLPADV VVVLRTSENK LLQQLFSIPL TKTGNLAQTR ARITVASSSL
910 920 930 940 950
PPHFSAGKAK VDTLEVIRHP EETTNMKRQT VASYFRYSLM DLLSKMVVGQ
960 970 980 990 1000
PHFVRCIKPN DDREALQFSR ERVLAQLRST GILETVSIRR QGYSHRILFE
1010 1020 1030 1040 1050
EFVKRYYYLA FTAHQTPLAS KESCVAILEK SRLDHWVLGK TKVFLKYYHV
1060 1070 1080 1090 1100
EQLNLLLREV IGRVVVLQAY TKGWLGARRY KRVREKREKG AIAIQSAWRG
1110 1120 1130 1140 1150
YDARRKFKKI SNRRNESAAH NQAGDTSNQS SGPHSPVAAG TRGSAEVQDC
1160 1170 1180 1190 1200
SEPGDHKVLR GSVHRRSHSQ AESNNGRTQT SSNSPAVTEK NGHSQAQSSP
1210 1220 1230 1240 1250
KGCDIFAGHA NKHSVSGTDL LSSRICHPAP DQQGLSLWGA PQKPGSENGL
1260 1270 1280 1290 1300
AQKHRTPRRR CQQPKMLSSP EDTMYYNQLN GTLEYQGSKR KPRKLGQIKV
1310 1320 1330 1340
LDGEDEYYKS LSPVDCIPEE NNSAHPSFFS SSSKGDSFAQ H
Length:1,341
Mass (Da):151,829
Last modified:May 18, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i76F84C571DAA269D
GO
Isoform 2 (identifier: Q8WXR4-2) [UniParc]FASTAAdd to basket
Also known as: MYO3B.0

The sequence of this isoform differs from the canonical sequence as follows:
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE

Show »
Length:1,278
Mass (Da):144,595
Checksum:i08890776C830E4A2
GO
Isoform 3 (identifier: Q8WXR4-3) [UniParc]FASTAAdd to basket
Also known as: MYO3B.1

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE

Show »
Length:1,251
Mass (Da):141,381
Checksum:i361E5B30B7EC31A9
GO
Isoform 4 (identifier: Q8WXR4-4) [UniParc]FASTAAdd to basket
Also known as: MYO3B.3

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.

Show »
Length:1,314
Mass (Da):148,615
Checksum:iF3A4479775B9C11B
GO
Isoform 5 (identifier: Q8WXR4-5) [UniParc]FASTAAdd to basket
Also known as: MYO3B.4

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: HSQAQSSPKG...SSKGDSFAQH → WSFTLLLRLE...YAILLQISKD

Show »
Length:1,275
Mass (Da):144,329
Checksum:i5FA002DEC199A3B1
GO
Isoform 6 (identifier: Q8WXR4-6) [UniParc]FASTAAdd to basket
Also known as: MYO3B.5

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: Missing.

Show »
Length:1,192
Mass (Da):135,407
Checksum:i28488BBC7CD00706
GO
Isoform 7 (identifier: Q8WXR4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQSALLSTR

Note: No experimental confirmation available.
Show »
Length:1,350
Mass (Da):152,799
Checksum:i4DFD8DBA81A82CBE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H2J1F5H2J1_HUMAN
Myosin-IIIb
MYO3B
1,105Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1M9H7C1M9_HUMAN
Myosin-IIIb
MYO3B
360Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti261K → R in BAB71011 (PubMed:14702039).Curated1
Sequence conflicti573T → A in BAB71011 (PubMed:14702039).Curated1
Sequence conflicti870K → M in AAL57233 (PubMed:11991710).Curated1
Sequence conflicti870K → M in AAO13799 (PubMed:11991710).Curated1
Sequence conflicti870K → M in AAO13800 (PubMed:11991710).Curated1
Sequence conflicti870K → M in AAO13801 (PubMed:11991710).Curated1
Sequence conflicti870K → M in AAO13802 (PubMed:11991710).Curated1
Sequence conflicti870K → M in AAO13803 (PubMed:11991710).Curated1
Sequence conflicti1081K → N in BAB71011 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04088621P → S1 PublicationCorresponds to variant dbSNP:rs35391761Ensembl.1
Natural variantiVAR_040887185R → H1 PublicationCorresponds to variant dbSNP:rs55911154Ensembl.1
Natural variantiVAR_040888267N → S1 PublicationCorresponds to variant dbSNP:rs34509373EnsemblClinVar.1
Natural variantiVAR_030605275I → V1 PublicationCorresponds to variant dbSNP:rs10209102Ensembl.1
Natural variantiVAR_030606309K → E2 PublicationsCorresponds to variant dbSNP:rs4668246Ensembl.1
Natural variantiVAR_040889316H → L1 PublicationCorresponds to variant dbSNP:rs55633190Ensembl.1
Natural variantiVAR_040890352E → Q1 PublicationCorresponds to variant dbSNP:rs56179904Ensembl.1
Natural variantiVAR_040891388N → S1 PublicationCorresponds to variant dbSNP:rs34273653Ensembl.1
Natural variantiVAR_030607406A → T1 PublicationCorresponds to variant dbSNP:rs10168181Ensembl.1
Natural variantiVAR_040892638Q → P1 PublicationCorresponds to variant dbSNP:rs55911627Ensembl.1
Natural variantiVAR_030608770V → I2 PublicationsCorresponds to variant dbSNP:rs6736609Ensembl.1
Natural variantiVAR_040893773E → G2 PublicationsCorresponds to variant dbSNP:rs33962844Ensembl.1
Natural variantiVAR_030609798E → K. Corresponds to variant dbSNP:rs11892763Ensembl.1
Natural variantiVAR_040894918R → Q1 PublicationCorresponds to variant dbSNP:rs55769829Ensembl.1
Natural variantiVAR_040895969S → C1 PublicationCorresponds to variant dbSNP:rs35857918Ensembl.1
Natural variantiVAR_040896990R → C1 PublicationCorresponds to variant dbSNP:rs34236931Ensembl.1
Natural variantiVAR_0306101082R → K2 PublicationsCorresponds to variant dbSNP:rs10185178Ensembl.1
Natural variantiVAR_0408971092I → V1 PublicationCorresponds to variant dbSNP:rs34219776Ensembl.1
Natural variantiVAR_0408981137V → I1 PublicationCorresponds to variant dbSNP:rs34546065Ensembl.1
Natural variantiVAR_0408991165R → C1 PublicationCorresponds to variant dbSNP:rs56052422Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0231111M → MLQSALLSTR in isoform 7. 1 Publication1
Alternative sequenceiVSP_0101621097 – 1123Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_0101641193 – 1341HSQAQ…SFAQH → WSFTLLLRLECNSMISADCN LRPLGSSDSPASASRVAGIT GIHKPRVLQKGAISSQDMQT STRFLGLICCLLGYAILLQI SKD in isoform 5. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_0101651193 – 1341Missing in isoform 6. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_0101631245 – 1341GSENG…SFAQH → AFPHYGCNFYGFRKWSCTEA SNTSPTMSAAQNAE in isoform 2 and isoform 3. 1 PublicationAdd BLAST97

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF369908 mRNA Translation: AAL57233.1
AF391554 mRNA Translation: AAO13799.1
AF391555 mRNA Translation: AAO13800.1
AF391556 mRNA Translation: AAO13801.1
AF391557 mRNA Translation: AAO13802.1
AF391558 mRNA Translation: AAO13803.1
AC007277 Genomic DNA No translation available.
AC012594 Genomic DNA Translation: AAY24324.1
AC068280 Genomic DNA No translation available.
AC093402 Genomic DNA No translation available.
AC114794 Genomic DNA Translation: AAY24159.1
AK055778 mRNA Translation: BAB71011.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42773.1 [Q8WXR4-1]
CCDS46446.1 [Q8WXR4-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001077084.2, NM_001083615.3 [Q8WXR4-4]
NP_620482.3, NM_138995.4 [Q8WXR4-1]
XP_006712362.1, XM_006712299.3 [Q8WXR4-7]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.671900

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317935; ENSP00000314650; ENSG00000071909 [Q8WXR4-3]
ENST00000408978; ENSP00000386213; ENSG00000071909 [Q8WXR4-1]
ENST00000409044; ENSP00000386497; ENSG00000071909 [Q8WXR4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
140469

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:140469

UCSC genome browser

More...
UCSCi
uc002ufy.4 human [Q8WXR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF369908 mRNA Translation: AAL57233.1
AF391554 mRNA Translation: AAO13799.1
AF391555 mRNA Translation: AAO13800.1
AF391556 mRNA Translation: AAO13801.1
AF391557 mRNA Translation: AAO13802.1
AF391558 mRNA Translation: AAO13803.1
AC007277 Genomic DNA No translation available.
AC012594 Genomic DNA Translation: AAY24324.1
AC068280 Genomic DNA No translation available.
AC093402 Genomic DNA No translation available.
AC114794 Genomic DNA Translation: AAY24159.1
AK055778 mRNA Translation: BAB71011.1
CCDSiCCDS42773.1 [Q8WXR4-1]
CCDS46446.1 [Q8WXR4-4]
RefSeqiNP_001077084.2, NM_001083615.3 [Q8WXR4-4]
NP_620482.3, NM_138995.4 [Q8WXR4-1]
XP_006712362.1, XM_006712299.3 [Q8WXR4-7]
UniGeneiHs.671900

3D structure databases

ProteinModelPortaliQ8WXR4
SMRiQ8WXR4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126621, 6 interactors
IntActiQ8WXR4, 4 interactors
STRINGi9606.ENSP00000386213

Chemistry databases

BindingDBiQ8WXR4
ChEMBLiCHEMBL5654

PTM databases

iPTMnetiQ8WXR4
PhosphoSitePlusiQ8WXR4

Polymorphism and mutation databases

BioMutaiMYO3B
DMDMi296439486

Proteomic databases

MaxQBiQ8WXR4
PaxDbiQ8WXR4
PeptideAtlasiQ8WXR4
PRIDEiQ8WXR4
ProteomicsDBi75080
75081 [Q8WXR4-2]
75082 [Q8WXR4-3]
75083 [Q8WXR4-4]
75084 [Q8WXR4-5]
75085 [Q8WXR4-6]
75086 [Q8WXR4-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317935; ENSP00000314650; ENSG00000071909 [Q8WXR4-3]
ENST00000408978; ENSP00000386213; ENSG00000071909 [Q8WXR4-1]
ENST00000409044; ENSP00000386497; ENSG00000071909 [Q8WXR4-4]
GeneIDi140469
KEGGihsa:140469
UCSCiuc002ufy.4 human [Q8WXR4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
140469
DisGeNETi140469
EuPathDBiHostDB:ENSG00000071909.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYO3B

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0002580
HGNCiHGNC:15576 MYO3B
HPAiHPA045483
MIMi610040 gene
neXtProtiNX_Q8WXR4
OpenTargetsiENSG00000071909
PharmGKBiPA31406

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0587 Eukaryota
KOG4229 Eukaryota
COG5022 LUCA
GeneTreeiENSGT00940000159309
HOVERGENiHBG052555
InParanoidiQ8WXR4
KOiK08834
OMAiRPYHVED
OrthoDBiEOG091G00C2
PhylomeDBiQ8WXR4
TreeFamiTF326512

Enzyme and pathway databases

SignaLinkiQ8WXR4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MYO3B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
140469

Protein Ontology

More...
PROi
PR:Q8WXR4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000071909 Expressed in 57 organ(s), highest expression level in caput epididymis
ExpressionAtlasiQ8WXR4 baseline and differential
GenevisibleiQ8WXR4 HS

Family and domain databases

CDDicd01379 MYSc_Myo3, 1 hit
Gene3Di3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR011009 Kinase-like_dom_sf
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR036083 MYSc_Myo3
IPR027417 P-loop_NTPase
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00612 IQ, 1 hit
PF00063 Myosin_head, 1 hit
PF00069 Pkinase, 1 hit
PRINTSiPR00193 MYOSINHEAVY
SMARTiView protein in SMART
SM00015 IQ, 2 hits
SM00242 MYSc, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 2 hits
PS51456 MYOSIN_MOTOR, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYO3B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WXR4
Secondary accession number(s): B8ZZR2
, Q53QE1, Q53T08, Q8IX64, Q8IX65, Q8IX66, Q8IX67, Q8IX68, Q96N94
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: May 18, 2010
Last modified: December 5, 2018
This is version 154 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again