Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (07 Apr 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Gamma-crystallin N

Gene

CRYGN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

In contrast to the orthologous protein found in other species, the C-terminal part differs and lacks the fourth beta/gamma crystallin 'Greek key' domain. Moreover, its non-specific tissue specificity suggests that it may have lost its function (PubMed:15853812).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WXF5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gamma-crystallin NCurated
Alternative name(s):
Gamma-N-crystallinCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CRYGNImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20458, CRYGN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609603, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WXF5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000127377.8

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134870586

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WXF5, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CRYGN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74727349

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003112811 – 182Gamma-crystallin NAdd BLAST182

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WXF5

PRoteomics IDEntifications database

More...
PRIDEi
Q8WXF5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75026 [Q8WXF5-1]
75027 [Q8WXF5-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8WXF5-1 [Q8WXF5-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WXF5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WXF5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Not specifically expressed in eye.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000127377, Expressed in right lobe of thyroid gland and 102 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WXF5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WXF5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000127377, Tissue enhanced (seminal vesicle, thyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127571, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000338613

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WXF5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WXF5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 46Beta/gamma crystallin 'Greek key' 1PROSITE-ProRule annotationAdd BLAST41
Domaini47 – 89Beta/gamma crystallin 'Greek key' 2PROSITE-ProRule annotationAdd BLAST43
Domaini95 – 136Beta/gamma crystallin 'Greek key' 3PROSITE-ProRule annotationAdd BLAST42

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the beta/gamma-crystallin family.Curated

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QV8X, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159301

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_081883_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WXF5

Identification of Orthologs from Complete Genome Data

More...
OMAi
MHGQHYR

Database of Orthologous Groups

More...
OrthoDBi
1445128at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WXF5

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001064, Beta/gamma_crystallin
IPR011024, G_crystallin-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00030, Crystall, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01367, BGCRYSTALLIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00247, XTALbg, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49695, SSF49695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50915, CRYSTALLIN_BETA_GAMMA, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WXF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQRSGKITL YEGKHFTGQK LEVFGDCDNF QDRGFMNRVN SIHVESGAWV
60 70 80 90 100
CFNHPDFRGQ QFILEHGDYP DFFRWNSHSD HMGSCRPVGM HGEHFRLEIF
110 120 130 140 150
EGCNFTGQCL EFLEDSPFLQ SRGWVKNCVN TIKVYGDGAA WSPRSFGAED
160 170 180
FQLSSSLQSD QGPEEATTKP ATTQPPFLTA NL
Length:182
Mass (Da):20,624
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i761F381A8BDFDDF1
GO
Isoform 2 (identifier: Q8WXF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-125: HGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWV → VSGPVHRRLSLPAGGTEGQPWQTVARNRGAWSSRL
     126-182: Missing.

Show »
Length:125
Mass (Da):14,224
Checksum:i41B1B2CBCF3D2CB8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PRF4A0A1W2PRF4_HUMAN
Gamma-crystallin N
CRYGN
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y702A0A2R8Y702_HUMAN
Gamma-crystallin N
CRYGN
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02950791 – 125HGEHF…SRGWV → VSGPVHRRLSLPAGGTEGQP WQTVARNRGAWSSRL in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_029508126 – 182Missing in isoform 2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF445455 mRNA Translation: AAL40968.1
CH471173 Genomic DNA Translation: EAW53992.1
BC100878 mRNA Translation: AAI00879.1
BC100879 mRNA Translation: AAI00880.1
BC100880 mRNA Translation: AAI00881.1
BC100881 mRNA Translation: AAI00882.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5926.1 [Q8WXF5-1]
CCDS78289.1 [Q8WXF5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001295221.1, NM_001308292.1 [Q8WXF5-2]
NP_653328.1, NM_144727.2 [Q8WXF5-1]
XP_016867262.1, XM_017011773.1 [Q8WXF5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000337323; ENSP00000338613; ENSG00000127377 [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377 [Q8WXF5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
155051

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:155051

UCSC genome browser

More...
UCSCi
uc003wke.4, human [Q8WXF5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF445455 mRNA Translation: AAL40968.1
CH471173 Genomic DNA Translation: EAW53992.1
BC100878 mRNA Translation: AAI00879.1
BC100879 mRNA Translation: AAI00880.1
BC100880 mRNA Translation: AAI00881.1
BC100881 mRNA Translation: AAI00882.1
CCDSiCCDS5926.1 [Q8WXF5-1]
CCDS78289.1 [Q8WXF5-2]
RefSeqiNP_001295221.1, NM_001308292.1 [Q8WXF5-2]
NP_653328.1, NM_144727.2 [Q8WXF5-1]
XP_016867262.1, XM_017011773.1 [Q8WXF5-2]

3D structure databases

SMRiQ8WXF5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127571, 3 interactors
STRINGi9606.ENSP00000338613

PTM databases

iPTMnetiQ8WXF5
PhosphoSitePlusiQ8WXF5

Genetic variation databases

BioMutaiCRYGN
DMDMi74727349

Proteomic databases

PaxDbiQ8WXF5
PRIDEiQ8WXF5
ProteomicsDBi75026 [Q8WXF5-1]
75027 [Q8WXF5-2]
TopDownProteomicsiQ8WXF5-1 [Q8WXF5-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
64394, 48 antibodies

Genome annotation databases

EnsembliENST00000337323; ENSP00000338613; ENSG00000127377 [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377 [Q8WXF5-2]
GeneIDi155051
KEGGihsa:155051
UCSCiuc003wke.4, human [Q8WXF5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
155051

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CRYGN
HGNCiHGNC:20458, CRYGN
HPAiENSG00000127377, Tissue enhanced (seminal vesicle, thyroid gland)
MIMi609603, gene
neXtProtiNX_Q8WXF5
PharmGKBiPA134870586
VEuPathDBiHostDB:ENSG00000127377.8

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QV8X, Eukaryota
GeneTreeiENSGT00940000159301
HOGENOMiCLU_081883_1_0_1
InParanoidiQ8WXF5
OMAiMHGQHYR
OrthoDBi1445128at2759
PhylomeDBiQ8WXF5

Enzyme and pathway databases

PathwayCommonsiQ8WXF5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
155051, 4 hits in 981 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
155051
PharosiQ8WXF5, Tdark

Protein Ontology

More...
PROi
PR:Q8WXF5
RNActiQ8WXF5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000127377, Expressed in right lobe of thyroid gland and 102 other tissues
ExpressionAtlasiQ8WXF5, baseline and differential
GenevisibleiQ8WXF5, HS

Family and domain databases

InterProiView protein in InterPro
IPR001064, Beta/gamma_crystallin
IPR011024, G_crystallin-like
PfamiView protein in Pfam
PF00030, Crystall, 2 hits
PRINTSiPR01367, BGCRYSTALLIN
SMARTiView protein in SMART
SM00247, XTALbg, 1 hit
SUPFAMiSSF49695, SSF49695, 1 hit
PROSITEiView protein in PROSITE
PS50915, CRYSTALLIN_BETA_GAMMA, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCRGN_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WXF5
Secondary accession number(s): Q496G6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 1, 2002
Last modified: April 7, 2021
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again