Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8WXE9 (STON2_HUMAN)

Entry version 162 (02 Dec 2020)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Stonin-2

Gene

STON2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein involved in endocytic machinery. Involved in the synaptic vesicle recycling. May facilitate clathrin-coated vesicle uncoating.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • clathrin adaptor activity Source: GO_Central
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8WXE9

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8WXE9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Stonin-2
Alternative name(s):
Stoned B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STON2
Synonyms:STN2, STNB
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000140022.9

Human Gene Nomenclature Database

More...HGNCi		HGNC:30652, STON2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608467, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8WXE9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi738W → A: Reduces interaction with SYT1. 1 Publication1
Mutagenesisi740K → A: Reduces interaction with SYT1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		85439

Open Targets

More...OpenTargetsi		ENSG00000140022

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA143485624

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8WXE9, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STON2

Domain mapping of disease mutations (DMDM)

More...DMDMi		34098614

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001857321 – 905Stonin-2Add BLAST905

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei255PhosphothreonineBy similarity1
Modified residuei281PhosphoserineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei762PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in vitro by PKD.1 Publication
Neddylated; deneddylated via its interaction with the COP9 signalosome (CSN) complex through TOR1A and COPS4.1 Publication
Ubiquitinated; leading to its degradation.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8WXE9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8WXE9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8WXE9

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8WXE9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8WXE9

PeptideAtlas

More...PeptideAtlasi		Q8WXE9

PRoteomics IDEntifications database

More...PRIDEi		Q8WXE9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		32734
75021 [Q8WXE9-1]

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		Q8WXE9

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8WXE9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8WXE9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000140022, Expressed in kidney and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8WXE9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8WXE9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000140022, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the second C2 domain of synaptotagmins SYT1 and SYT2.

Interacts with EPS15, EPS15R and ITSN1.

Interacts indirectly with the AP-2 adapter complex.

Interacts with TOR1A and COPS4; the interaction controls STON2 protein stability.

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124526, 58 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8WXE9

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q8WXE9

Protein interaction database and analysis system

More...IntActi		Q8WXE9, 46 interactors

Molecular INTeraction database

More...MINTi		Q8WXE9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000450857

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8WXE9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1905
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q8WXE9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8WXE9

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8WXE9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini427 – 560SHDPROSITE-ProRule annotationAdd BLAST134
Domaini568 – 878MHDPROSITE-ProRule annotationAdd BLAST311

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi313 – 315NPF 13
Motifi329 – 331NPF 23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Asn-Pro-Phe (NPF) motifs, which are found in proteins involved in the endocytic pathway, mediate the interaction with the EH domain of SYT1, SYT2, EPS15, EPS15R and ITSN1.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Stoned B family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2677, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159392

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_016541_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8WXE9

Identification of Orthologs from Complete Genome Data

More...OMAi		WIELDDH

Database of Orthologous Groups

More...OrthoDBi		1059322at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8WXE9

TreeFam database of animal gene trees

More...TreeFami		TF300393

Family and domain databases

Database of protein disorder

More...DisProti		DP01368

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR036168, AP2_Mu_C_sf
IPR028565, MHD
IPR012320, SHD_dom
IPR031228, STON2
IPR017110, Stonin
IPR022699, Stonin2_N

The PANTHER Classification System

More...PANTHERi		PTHR10529:SF345, PTHR10529:SF345, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00928, Adap_comp_sub, 1 hit
PF12016, Stonin2_N, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037099, Stonin, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49447, SSF49447, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51072, MHD, 1 hit
PS51070, SHD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WXE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTLDHVIAT HQSEWVSFNE EPPFPAHSQG GTEEHLPGLS SSPDQSESSS 
        60         70         80         90        100
GENHVVDGGS QDHSHSEQDD SSEKMGLISE AASPPGSPEQ PPPDLASAIS 
       110        120        130        140        150
NWVQFEDDTP WASTSPPHQE TAETALPLTM PCWTCPSFDS LGRCPLTSES 
       160        170        180        190        200
SWTTHSEDTS SPSFGCSYTD LQLINAEEQT SGQASGADST DNSSSLQEDE 
       210        220        230        240        250
EVEMEAISWQ ASSPAMNGHP APPVTSARFP SWVTFDDNEV SCPLPPVTSP 
       260        270        280        290        300
LKPNTPPSAS VIPDVPYNSM GSFKKRDRPK STLMNFSKVQ KLDISSLNRT 
       310        320        330        340        350
PSVTEASPWR ATNPFLNETL QDVQPSPINP FSAFFEEQER RSQNSSISST 
       360        370        380        390        400
TGKSQRDSLI VIYQDAISFD DSSKTQSHSD AVEKLKQLQI DDPDHFGSAT 
       410        420        430        440        450
LPDDDPVAWI ELDAHPPGSA RSQPRDGWPM MLRIPEKKNI MSSRHWGPIF 
       460        470        480        490        500
VKLTDTGYLQ LYYEQGLEKP FREFKLEICH EISEPRLQNY DENGRIHSLR 
       510        520        530        540        550
IDRVTYKEKK KYQPKPAVAH TAEREQVIKL GTTNYDDFLS FIHAVQDRLM 
       560        570        580        590        600
DLPVLSMDLS TVGLNYLEEE ITVDVRDEFS GIVSKGDNQI LQHHVLTRIH 
       610        620        630        640        650
ILSFLSGLAE CRLGLNDILV KGNEIVLRQD IMPTTTTKWI KLHECRFHGC 
       660        670        680        690        700
VDEDVFHNSR VILFNPLDAC RFELMRFRTV FAEKTLPFTL RTATSVNGAE 
       710        720        730        740        750
VEVQSWLRMS TGFSANRDPL TQVPCENVMI RYPVPSEWVK NFRRESVLGE 
       760        770        780        790        800
KSLKAKVNRG ASFGSTSVSG SEPVMRVTLG TAKYEHAFNS IVWRINRLPD 
       810        820        830        840        850
KNSASGHPHC FFCHLELGSD REVPSRFANH VNVEFSMPTT SASKASVRSI 
       860        870        880        890        900
SVEDKTDVRK WVNYSAHYSY QVALGSIWLM LPTPFVHPTT LPLLFLLAML 

TMFAW
Length:905
Mass (Da):101,165
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i59F5810DEC540CA3
GO
Isoform 2 (identifier: Q8WXE9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     872-905: VALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW → TTETDNLPNP...PLASSIRTMV

Show »
Length:920
Mass (Da):102,835
Checksum:i85140C1E96940A27
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3IU55A0A3B3IU55_HUMAN
Stonin-2
STON2
977Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V322G3V322_HUMAN
Stonin-2
STON2
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJ05H0YJ05_HUMAN
Stonin-2
STON2
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAK57558 differs from that shown. Intron retention.Curated
The sequence AAK57558 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAK76362 differs from that shown. Reason: Frameshift.Curated
The sequence BAD92185 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti121 – 122TA → NS in AAK76362 (PubMed:11454741).Curated2
Isoform 2 (identifier: Q8WXE9-3)
Sequence conflicti899V → L in BAD92185 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020182307S → P3 PublicationsCorresponds to variant dbSNP:rs3813535Ensembl.1
Natural variantiVAR_046643646R → H. Corresponds to variant dbSNP:rs34323725Ensembl.1
Natural variantiVAR_046644694T → A. Corresponds to variant dbSNP:rs35689202Ensembl.1
Natural variantiVAR_021912851S → A. Corresponds to variant dbSNP:rs2241621Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044863872 – 905VALGS…TMFAW → TTETDNLPNPLYCSCLPHTD LKRGSKRVVKIRWNASLEVP LASSIRTMV in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF380833 mRNA Translation: AAK76362.1 Frameshift.
AF449430 mRNA Translation: AAL47008.1
AB208948 mRNA Translation: BAD92185.1 Different initiation.
AL121769 Genomic DNA No translation available.
AL136040 Genomic DNA No translation available.
BC069389 mRNA Translation: AAH69389.1
BC117493 mRNA Translation: AAI17494.1
AF255309 mRNA Translation: AAK57558.1 Sequence problems.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS58332.1 [Q8WXE9-3]

NCBI Reference Sequences

More...RefSeqi		NP_001243359.1, NM_001256430.1 [Q8WXE9-3]
NP_149095.2, NM_033104.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000555447; ENSP00000450857; ENSG00000140022 [Q8WXE9-3]
ENST00000614646; ENSP00000477736; ENSG00000140022 [Q8WXE9-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		85439

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:85439

UCSC genome browser

More...UCSCi		uc001xvk.3, human [Q8WXE9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF380833 mRNA Translation: AAK76362.1 Frameshift.
AF449430 mRNA Translation: AAL47008.1
AB208948 mRNA Translation: BAD92185.1 Different initiation.
AL121769 Genomic DNA No translation available.
AL136040 Genomic DNA No translation available.
BC069389 mRNA Translation: AAH69389.1
BC117493 mRNA Translation: AAI17494.1
AF255309 mRNA Translation: AAK57558.1 Sequence problems.
CCDSiCCDS58332.1 [Q8WXE9-3]
RefSeqiNP_001243359.1, NM_001256430.1 [Q8WXE9-3]
NP_149095.2, NM_033104.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JXCNMR-B301-340[»]
BMRBiQ8WXE9
SMRiQ8WXE9
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi124526, 58 interactors
CORUMiQ8WXE9
ELMiQ8WXE9
IntActiQ8WXE9, 46 interactors
MINTiQ8WXE9
STRINGi9606.ENSP00000450857

PTM databases

CarbonylDBiQ8WXE9
iPTMnetiQ8WXE9
PhosphoSitePlusiQ8WXE9

Polymorphism and mutation databases

BioMutaiSTON2
DMDMi34098614

Proteomic databases

EPDiQ8WXE9
jPOSTiQ8WXE9
MassIVEiQ8WXE9
MaxQBiQ8WXE9
PaxDbiQ8WXE9
PeptideAtlasiQ8WXE9
PRIDEiQ8WXE9
ProteomicsDBi32734
75021 [Q8WXE9-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q8WXE9, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		164, 22 antibodies

The DNASU plasmid repository

More...DNASUi		85439

Genome annotation databases

EnsembliENST00000555447; ENSP00000450857; ENSG00000140022 [Q8WXE9-3]
ENST00000614646; ENSP00000477736; ENSG00000140022 [Q8WXE9-3]
GeneIDi85439
KEGGihsa:85439
UCSCiuc001xvk.3, human [Q8WXE9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		85439
DisGeNETi85439
EuPathDBiHostDB:ENSG00000140022.9

GeneCards: human genes, protein and diseases

More...GeneCardsi		STON2
HGNCiHGNC:30652, STON2
HPAiENSG00000140022, Low tissue specificity
MIMi608467, gene
neXtProtiNX_Q8WXE9
OpenTargetsiENSG00000140022
PharmGKBiPA143485624

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2677, Eukaryota
GeneTreeiENSGT00940000159392
HOGENOMiCLU_016541_0_0_1
InParanoidiQ8WXE9
OMAiWIELDDH
OrthoDBi1059322at2759
PhylomeDBiQ8WXE9
TreeFamiTF300393

Enzyme and pathway databases

PathwayCommonsiQ8WXE9
ReactomeiR-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
SignaLinkiQ8WXE9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		85439, 6 hits in 848 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		STON2, human
EvolutionaryTraceiQ8WXE9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		85439
PharosiQ8WXE9, Tbio

Protein Ontology

More...PROi		PR:Q8WXE9
RNActiQ8WXE9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000140022, Expressed in kidney and 196 other tissues
ExpressionAtlasiQ8WXE9, baseline and differential
GenevisibleiQ8WXE9, HS

Family and domain databases

DisProtiDP01368
InterProiView protein in InterPro
IPR036168, AP2_Mu_C_sf
IPR028565, MHD
IPR012320, SHD_dom
IPR031228, STON2
IPR017110, Stonin
IPR022699, Stonin2_N
PANTHERiPTHR10529:SF345, PTHR10529:SF345, 1 hit
PfamiView protein in Pfam
PF00928, Adap_comp_sub, 1 hit
PF12016, Stonin2_N, 1 hit
PIRSFiPIRSF037099, Stonin, 1 hit
SUPFAMiSSF49447, SSF49447, 1 hit
PROSITEiView protein in PROSITE
PS51072, MHD, 1 hit
PS51070, SHD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTON2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WXE9
Secondary accession number(s): G3V2T7
, Q17R24, Q59H11, Q6NT47, Q96RI7, Q96RU6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: March 1, 2002
Last modified: December 2, 2020
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again