Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (13 Feb 2019)
Sequence version 3 (28 Mar 2018)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

RUN and FYVE domain-containing protein 2

Gene

RUFY2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri540 – 598FYVE-typePROSITE-ProRule annotationAdd BLAST59

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • SH3 domain binding Source: UniProtKB

GO - Biological processi

  • regulation of endocytosis Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RUN and FYVE domain-containing protein 2
Alternative name(s):
Rab4-interacting protein related
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RUFY2
Synonyms:KIAA1537, RABIP4R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204130.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19761 RUFY2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610328 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WXA3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204130

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134935922

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RUFY2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
110287949

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002458301 – 606RUN and FYVE domain-containing protein 2Add BLAST606

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WXA3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WXA3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WXA3

PeptideAtlas

More...
PeptideAtlasi
Q8WXA3

PRoteomics IDEntifications database

More...
PRIDEi
Q8WXA3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74994
74995 [Q8WXA3-2]
74996 [Q8WXA3-3]
74997 [Q8WXA3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WXA3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WXA3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, lung and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204130 Expressed in 162 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WXA3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WXA3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039792

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BMX.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120809, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WXA3, 9 interactors

Molecular INTeraction database

More...
MINTi
Q8WXA3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373420

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8WXA3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WXA3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 169RUNPROSITE-ProRule annotationAdd BLAST133

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili210 – 534Sequence analysisAdd BLAST325

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri540 – 598FYVE-typePROSITE-ProRule annotationAdd BLAST59

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4381 Eukaryota
ENOG410XRAX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155595

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000030913

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057053

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WXA3

Identification of Orthologs from Complete Genome Data

More...
OMAi
LQECQSK

Database of Orthologous Groups

More...
OrthoDBi
753155at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WXA3

TreeFam database of animal gene trees

More...
TreeFami
TF323904

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR000306 Znf_FYVE
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01363 FYVE, 1 hit
PF02759 RUN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00064 FYVE, 1 hit
SM00593 RUN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF140741 SSF140741, 1 hit
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50826 RUN, 1 hit
PS50178 ZF_FYVE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WXA3-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATKDPTAVE RANLLNMAKL SIKGLIESAL SFGRTLDSDY PPLQQFFVVM
60 70 80 90 100
EHCLKHGLKV RKSFLSYNKT IWGPLELVEK LYPEAEEIGA SVRDLPGLKT
110 120 130 140 150
PLGRARAWLR LALMQKKMAD YLRCLIIQRD LLSEFYEYHA LMMEEEGAVI
160 170 180 190 200
VGLLVGLNVI DANLCVKGED LDSQVGVIDF SMYLKNEEDI GNKERNVQIA
210 220 230 240 250
AILDQKNYVE ELNRQLNSTV SSLHSRVDSL EKSNTKLIEE LAIAKNNIIK
260 270 280 290 300
LQEENHQLRS ENKLILMKTQ QHLEVTKVDV ETELQTYKHS RQGLDEMYNE
310 320 330 340 350
ARRQLRDESQ LRQDVENELA VQVSMKHEIE LAMKLLEKDI HEKQDTLIGL
360 370 380 390 400
RQQLEEVKAI NIEMYQKLQG SEDGLKEKNE IIARLEEKTN KITAAMRQLE
410 420 430 440 450
QRLQQAEKAQ MEAEDEDEKY LQECLSKSDS LQKQISQKEK QLVQLETDLK
460 470 480 490 500
IEKEWRQTLQ EDLQKEKDAL SHLRNETQQI ISLKKEFLNL QDENQQLKKI
510 520 530 540 550
YHEQEQALQE LGNKLSESKL KIEDIKEANK ALQGLVWLKD KEATHCKLCE
560 570 580 590 600
KEFSLSKRKH HCRNCGEIFC NACSDNELPL PSSPKPVRVC DSCHALLIQR

CSSNLP
Length:606
Mass (Da):70,010
Last modified:March 28, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBD1100777070BE4A
GO
Isoform 5 (identifier: Q8WXA3-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGP

Note: No experimental confirmation available.Curated
Show »
Length:655
Mass (Da):75,055
Checksum:i5A00F18CE81278BE
GO
Isoform 2 (identifier: Q8WXA3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTFQVWGWRREDASQVLAWVPDAEGGRRGMLTRRSL

Show »
Length:641
Mass (Da):74,081
Checksum:i9CF9E30FD8E1FC42
GO
Isoform 3 (identifier: Q8WXA3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     99-133: KTPLGRARAWLRLALMQKKMADYLRCLIIQRDLLS → N
     402-437: RLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQ → SDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
     438-606: Missing.

Show »
Length:403
Mass (Da):46,136
Checksum:i76975482950240A0
GO
Isoform 4 (identifier: Q8WXA3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-59: Missing.
     402-437: RLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQ → SDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
     438-606: Missing.

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):43,720
Checksum:i852A5A56D2257217
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YD93H0YD93_HUMAN
RUN and FYVE domain-containing prot...
RUFY2
620Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3P2S4R3P2_HUMAN
RUN and FYVE domain-containing prot...
RUFY2
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060318573C → S. Corresponds to variant dbSNP:rs11816774Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0595051M → MTFQVWGWRREDASQVLAWV PDAEGGRRGMLTRRSL in isoform 2. 1
Alternative sequenceiVSP_0595061M → MGGDCLGLGGSRGRHGNAPP PLFRPVPARVLRHSGRGLEV PRRPGARTGP in isoform 5. 1
Alternative sequenceiVSP_0595072 – 59Missing in isoform 4. Add BLAST58
Alternative sequenceiVSP_05950899 – 133KTPLG…RDLLS → N in isoform 3. Add BLAST35
Alternative sequenceiVSP_059509402 – 437RLQQA…KQISQ → SDNDLLTQTRTIAMSLVKCA SSDTQDQYKLVKDISF in isoform 3 and isoform 4. Add BLAST36
Alternative sequenceiVSP_059510438 – 606Missing in isoform 3 and isoform 4. Add BLAST169

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF461266 mRNA Translation: AAL67520.1
AB040970 mRNA Translation: BAA96061.1
AK127019 mRNA Translation: BAG54424.1
AK294211 mRNA Translation: BAG57521.1
AL136233 Genomic DNA No translation available.
AC016395 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54294.1
BC041092 mRNA Translation: AAH41092.1
AF411980 mRNA Translation: AAL04164.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41534.1 [Q8WXA3-3]
CCDS44414.1 [Q8WXA3-4]
CCDS60544.1 [Q8WXA3-5]
CCDS81470.1 [Q8WXA3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001035882.1, NM_001042417.1 [Q8WXA3-4]
NP_001265154.1, NM_001278225.1 [Q8WXA3-5]
NP_001317032.1, NM_001330103.1 [Q8WXA3-2]
NP_060457.4, NM_017987.4 [Q8WXA3-3]
XP_005270012.1, XM_005269955.4
XP_011538244.1, XM_011539942.2 [Q8WXA3-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.653144

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000388768; ENSP00000373420; ENSG00000204130 [Q8WXA3-3]
ENST00000399200; ENSP00000382151; ENSG00000204130 [Q8WXA3-4]
ENST00000454950; ENSP00000404986; ENSG00000204130 [Q8WXA3-5]
ENST00000602465; ENSP00000473462; ENSG00000204130 [Q8WXA3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55680

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55680

UCSC genome browser

More...
UCSCi
uc001job.4 human [Q8WXA3-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461266 mRNA Translation: AAL67520.1
AB040970 mRNA Translation: BAA96061.1
AK127019 mRNA Translation: BAG54424.1
AK294211 mRNA Translation: BAG57521.1
AL136233 Genomic DNA No translation available.
AC016395 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54294.1
BC041092 mRNA Translation: AAH41092.1
AF411980 mRNA Translation: AAL04164.1
CCDSiCCDS41534.1 [Q8WXA3-3]
CCDS44414.1 [Q8WXA3-4]
CCDS60544.1 [Q8WXA3-5]
CCDS81470.1 [Q8WXA3-2]
RefSeqiNP_001035882.1, NM_001042417.1 [Q8WXA3-4]
NP_001265154.1, NM_001278225.1 [Q8WXA3-5]
NP_001317032.1, NM_001330103.1 [Q8WXA3-2]
NP_060457.4, NM_017987.4 [Q8WXA3-3]
XP_005270012.1, XM_005269955.4
XP_011538244.1, XM_011539942.2 [Q8WXA3-2]
UniGeneiHs.653144

3D structure databases

ProteinModelPortaliQ8WXA3
SMRiQ8WXA3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120809, 13 interactors
IntActiQ8WXA3, 9 interactors
MINTiQ8WXA3
STRINGi9606.ENSP00000373420

PTM databases

iPTMnetiQ8WXA3
PhosphoSitePlusiQ8WXA3

Polymorphism and mutation databases

BioMutaiRUFY2
DMDMi110287949

Proteomic databases

EPDiQ8WXA3
jPOSTiQ8WXA3
PaxDbiQ8WXA3
PeptideAtlasiQ8WXA3
PRIDEiQ8WXA3
ProteomicsDBi74994
74995 [Q8WXA3-2]
74996 [Q8WXA3-3]
74997 [Q8WXA3-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55680
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000388768; ENSP00000373420; ENSG00000204130 [Q8WXA3-3]
ENST00000399200; ENSP00000382151; ENSG00000204130 [Q8WXA3-4]
ENST00000454950; ENSP00000404986; ENSG00000204130 [Q8WXA3-5]
ENST00000602465; ENSP00000473462; ENSG00000204130 [Q8WXA3-2]
GeneIDi55680
KEGGihsa:55680
UCSCiuc001job.4 human [Q8WXA3-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55680
EuPathDBiHostDB:ENSG00000204130.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RUFY2
HGNCiHGNC:19761 RUFY2
HPAiHPA039792
MIMi610328 gene
neXtProtiNX_Q8WXA3
OpenTargetsiENSG00000204130
PharmGKBiPA134935922

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4381 Eukaryota
ENOG410XRAX LUCA
GeneTreeiENSGT00940000155595
HOGENOMiHOG000030913
HOVERGENiHBG057053
InParanoidiQ8WXA3
OMAiLQECQSK
OrthoDBi753155at2759
PhylomeDBiQ8WXA3
TreeFamiTF323904

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RUFY2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55680

Protein Ontology

More...
PROi
PR:Q8WXA3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204130 Expressed in 162 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ8WXA3 baseline and differential
GenevisibleiQ8WXA3 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR004012 Run_dom
IPR037213 Run_dom_sf
IPR000306 Znf_FYVE
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF01363 FYVE, 1 hit
PF02759 RUN, 1 hit
SMARTiView protein in SMART
SM00064 FYVE, 1 hit
SM00593 RUN, 1 hit
SUPFAMiSSF140741 SSF140741, 1 hit
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50826 RUN, 1 hit
PS50178 ZF_FYVE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRUFY2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WXA3
Secondary accession number(s): B3KXB2
, B4DFR0, Q5TC48, Q8IW33, Q96P51, Q9P1Z1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: March 28, 2018
Last modified: February 13, 2019
This is version 130 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again