Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 7

Gene

NLRP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits CASP1/caspase-1-dependent IL1B secretion.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi178 – 185ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • aspartic-type endopeptidase inhibitor activity Source: UniProtKB
  • ATP binding Source: UniProtKB-KW
  • caspase binding Source: UniProtKB
  • interleukin-1 binding Source: UniProtKB

GO - Biological processi

Keywordsi

LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 7
Alternative name(s):
Nucleotide-binding oligomerization domain protein 12
PYRIN-containing APAF1-like protein 3
Gene namesi
Name:NLRP7
Synonyms:NALP7, NOD12, PYPAF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000167634.12
HGNCiHGNC:22947 NLRP7
MIMi609661 gene
neXtProtiNX_Q8WX94

Pathology & Biotechi

Involvement in diseasei

Hydatidiform mole, recurrent, 1 (HYDM1)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by excessive trophoblast development that produces a growing mass of tissue inside the uterus at the beginning of a pregnancy. It leads to abnormal pregnancies with no embryo, and cystic degeneration of the chorionic villi.
See also OMIM:231090
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059035398L → R in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895548EnsemblClinVar.1
Natural variantiVAR_059036651P → S in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895549EnsemblClinVar.1
Natural variantiVAR_026711693R → P in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895502EnsemblClinVar.1
Natural variantiVAR_059037693R → Q in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895502EnsemblClinVar.1
Natural variantiVAR_026712693R → W in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895506EnsemblClinVar.1
Natural variantiVAR_059038716P → A in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895550EnsemblClinVar.1
Natural variantiVAR_059039721R → W in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895525EnsemblClinVar.1
Natural variantiVAR_059040761C → Y in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895552EnsemblClinVar.1
Natural variantiVAR_026713913N → S in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895503EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi199713
MalaCardsiNLRP7
MIMi231090 phenotype
OpenTargetsiENSG00000167634
Orphaneti254688 Complete hydatidiform mole
254693 Partial hydatidiform mole
PharmGKBiPA162398003

Polymorphism and mutation databases

BioMutaiNLRP7
DMDMi24212128

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000808951 – 980NACHT, LRR and PYD domains-containing protein 7Add BLAST980

Proteomic databases

MaxQBiQ8WX94
PeptideAtlasiQ8WX94
PRIDEiQ8WX94
ProteomicsDBi74988
74989 [Q8WX94-2]
74990 [Q8WX94-3]

PTM databases

iPTMnetiQ8WX94
PhosphoSitePlusiQ8WX94

Expressioni

Tissue specificityi

Expressed in numerous tissues including uterus and ovary, with low levels in heart and brain. Not detected in skeletal muscle.2 Publications

Inductioni

By bacterial lipopolysaccharides (LPS) and IL1B/interleukin-1 beta in peripheral blood mononuclear cells.

Gene expression databases

BgeeiENSG00000167634 Expressed in 42 organ(s), highest expression level in female gonad
CleanExiHS_NLRP7
ExpressionAtlasiQ8WX94 baseline and differential
GenevisibleiQ8WX94 HS

Organism-specific databases

HPAiHPA051382

Interactioni

Subunit structurei

Directly interacts with CASP1 and IL1B.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi128265, 2 interactors

Structurei

Secondary structure

1980
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8WX94
SMRiQ8WX94
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WX94

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 93PyrinPROSITE-ProRule annotationAdd BLAST93
Domaini172 – 491NACHTPROSITE-ProRule annotationAdd BLAST320
Repeati614 – 638LRR 1Add BLAST25
Repeati674 – 697LRR 2Add BLAST24
Repeati760 – 784LRR 3Add BLAST25
Repeati788 – 810LRR 4Add BLAST23
Repeati817 – 840LRR 5Add BLAST24
Repeati845 – 868LRR 6Add BLAST24
Repeati874 – 897LRR 7Add BLAST24
Repeati902 – 928LRR 8Add BLAST27
Repeati933 – 957LRR 9Add BLAST25

Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00900000140813
HOGENOMiHOG000294064
HOVERGENiHBG103856
InParanoidiQ8WX94
KOiK20864
OMAiDFCSLFS
OrthoDBiEOG091G01Q7
PhylomeDBiQ8WX94

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF05729 NACHT, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 2 hits
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS50837 NACHT, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WX94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSPQLEWTL QTLLEQLNED ELKSFKSLLW AFPLEDVLQK TPWSEVEEAD
60 70 80 90 100
GKKLAEILVN TSSENWIRNA TVNILEEMNL TELCKMAKAE MMEDGQVQEI
110 120 130 140 150
DNPELGDAEE DSELAKPGEK EGWRNSMEKQ SLVWKNTFWQ GDIDNFHDDV
160 170 180 190 200
TLRNQRFIPF LNPRTPRKLT PYTVVLHGPA GVGKTTLAKK CMLDWTDCNL
210 220 230 240 250
SPTLRYAFYL SCKELSRMGP CSFAELISKD WPELQDDIPS ILAQAQRILF
260 270 280 290 300
VVDGLDELKV PPGALIQDIC GDWEKKKPVP VLLGSLLKRK MLPRAALLVT
310 320 330 340 350
TRPRALRDLQ LLAQQPIYVR VEGFLEEDRR AYFLRHFGDE DQAMRAFELM
360 370 380 390 400
RSNAALFQLG SAPAVCWIVC TTLKLQMEKG EDPVPTCLTR TGLFLRFLCS
410 420 430 440 450
RFPQGAQLRG ALRTLSLLAA QGLWAQMSVF HREDLERLGV QESDLRLFLD
460 470 480 490 500
GDILRQDRVS KGCYSFIHLS FQQFLTALFY ALEKEEGEDR DGHAWDIGDV
510 520 530 540 550
QKLLSGEERL KNPDLIQVGH FLFGLANEKR AKELEATFGC RMSPDIKQEL
560 570 580 590 600
LQCKAHLHAN KPLSVTDLKE VLGCLYESQE EELAKVVVAP FKEISIHLTN
610 620 630 640 650
TSEVMHCSFS LKHCQDLQKL SLQVAKGVFL ENYMDFELDI EFERCTYLTI
660 670 680 690 700
PNWARQDLRS LRLWTDFCSL FSSNSNLKFL EVKQSFLSDS SVRILCDHVT
710 720 730 740 750
RSTCHLQKVE IKNVTPDTAY RDFCLAFIGK KTLTHLTLAG HIEWERTMML
760 770 780 790 800
MLCDLLRNHK CNLQYLRLGG HCATPEQWAE FFYVLKANQS LKHLRLSANV
810 820 830 840 850
LLDEGAMLLY KTMTRPKHFL QMLSLENCRL TEASCKDLAA VLVVSKKLTH
860 870 880 890 900
LCLAKNPIGD TGVKFLCEGL SYPDCKLQTL VLQQCSITKL GCRYLSEALQ
910 920 930 940 950
EACSLTNLDL SINQIARGLW ILCQALENPN CNLKHLRLKT YETNLEIKKL
960 970 980
LEEVKEKNPK LTIDCNASGA TAPPCCDFFC
Length:980
Mass (Da):111,807
Last modified:March 1, 2002 - v1
Checksum:i822AF2FD4338003D
GO
Isoform 2 (identifier: Q8WX94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     644-671: Missing.
     938-938: L → LWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKILRL

Note: No experimental confirmation available.
Show »
Length:1,009
Mass (Da):114,845
Checksum:iEB76450B0C05AE24
GO
Isoform 3 (identifier: Q8WX94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     938-938: L → LWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKILRL

Note: No experimental confirmation available.
Show »
Length:1,037
Mass (Da):118,303
Checksum:iBB5642CADF5DA666
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ERG0K7ERG0_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
963Annotation score:
A0A0G2JNK3A0A0G2JNK3_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
1,037Annotation score:
A0A0G2JNK1A0A0G2JNK1_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
952Annotation score:
A0A0G2JMB6A0A0G2JMB6_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
980Annotation score:
A0A0G2JPH3A0A0G2JPH3_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
1,009Annotation score:
A0A0G2JM25A0A0G2JM25_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
935Annotation score:
K7ER92K7ER92_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
96Annotation score:
K7EP54K7EP54_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
70Annotation score:
K7EPY3K7EPY3_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
53Annotation score:
A0A0G2JNS7A0A0G2JNS7_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP7
100Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti310 – 311QL → RI in AAI09126 (PubMed:15489334).Curated2
Sequence conflicti481A → T in AAI09126 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026710319V → I. Corresponds to variant dbSNP:rs775882EnsemblClinVar.1
Natural variantiVAR_059035398L → R in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895548EnsemblClinVar.1
Natural variantiVAR_060103487G → E. Corresponds to variant dbSNP:rs775881EnsemblClinVar.1
Natural variantiVAR_059036651P → S in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895549EnsemblClinVar.1
Natural variantiVAR_026711693R → P in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895502EnsemblClinVar.1
Natural variantiVAR_059037693R → Q in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895502EnsemblClinVar.1
Natural variantiVAR_026712693R → W in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895506EnsemblClinVar.1
Natural variantiVAR_059038716P → A in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895550EnsemblClinVar.1
Natural variantiVAR_059039721R → W in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895525EnsemblClinVar.1
Natural variantiVAR_059040761C → Y in HYDM1. 1 PublicationCorresponds to variant dbSNP:rs104895552EnsemblClinVar.1
Natural variantiVAR_026713913N → S in HYDM1. 2 PublicationsCorresponds to variant dbSNP:rs104895503EnsemblClinVar.1
Natural variantiVAR_026714971T → A. Corresponds to variant dbSNP:rs7256020Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016906644 – 671Missing in isoform 2. CuratedAdd BLAST28
Alternative sequenceiVSP_016907938L → LWSCSLMPFYCQHLGSALLS NQKLETLDLGQNHLWKSGII KLFGVLRQRTGSLKILRL in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464765 mRNA Translation: AAL69963.1
AY154462 mRNA Translation: AAO18158.1
AC011476 Genomic DNA No translation available.
BC109125 mRNA Translation: AAI09126.1
BK001113 mRNA Translation: DAA01246.1
CCDSiCCDS12912.1 [Q8WX94-2]
CCDS33109.1 [Q8WX94-1]
CCDS46183.1 [Q8WX94-3]
RefSeqiNP_001120727.1, NM_001127255.1 [Q8WX94-3]
NP_631915.2, NM_139176.3 [Q8WX94-2]
NP_996611.2, NM_206828.3 [Q8WX94-1]
XP_006723138.1, XM_006723075.3 [Q8WX94-3]
XP_006723139.1, XM_006723076.3 [Q8WX94-3]
XP_011524901.1, XM_011526599.2 [Q8WX94-3]
UniGeneiHs.351118

Genome annotation databases

EnsembliENST00000328092; ENSP00000329568; ENSG00000167634 [Q8WX94-2]
ENST00000340844; ENSP00000339491; ENSG00000167634 [Q8WX94-1]
ENST00000588756; ENSP00000467123; ENSG00000167634 [Q8WX94-3]
ENST00000590030; ENSP00000465520; ENSG00000167634 [Q8WX94-1]
ENST00000592784; ENSP00000468706; ENSG00000167634 [Q8WX94-3]
ENST00000610424; ENSP00000482887; ENSG00000274571 [Q8WX94-3]
ENST00000610790; ENSP00000478726; ENSG00000274571 [Q8WX94-1]
ENST00000610853; ENSP00000478890; ENSG00000274571 [Q8WX94-2]
ENST00000610981; ENSP00000479459; ENSG00000277776 [Q8WX94-3]
ENST00000611597; ENSP00000481117; ENSG00000274571 [Q8WX94-1]
ENST00000613233; ENSP00000483203; ENSG00000277776 [Q8WX94-1]
ENST00000614879; ENSP00000484444; ENSG00000277071 [Q8WX94-1]
ENST00000615426; ENSP00000484426; ENSG00000277071 [Q8WX94-3]
ENST00000615699; ENSP00000480449; ENSG00000277786 [Q8WX94-1]
ENST00000618261; ENSP00000483353; ENSG00000277179 [Q8WX94-1]
ENST00000618343; ENSP00000480226; ENSG00000274174 [Q8WX94-3]
ENST00000618672; ENSP00000481452; ENSG00000277179 [Q8WX94-3]
ENST00000618740; ENSP00000484808; ENSG00000277786 [Q8WX94-3]
ENST00000618995; ENSP00000481809; ENSG00000276804 [Q8WX94-1]
ENST00000620183; ENSP00000480034; ENSG00000274174 [Q8WX94-1]
ENST00000620820; ENSP00000482551; ENSG00000276804 [Q8WX94-3]
ENST00000621238; ENSP00000481395; ENSG00000274571 [Q8WX94-3]
ENST00000621584; ENSP00000479541; ENSG00000275483 [Q8WX94-1]
ENST00000622199; ENSP00000482194; ENSG00000275483 [Q8WX94-3]
GeneIDi199713
KEGGihsa:199713
UCSCiuc002qih.4 human [Q8WX94-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

INFEVERS

Repertory of FMF and hereditary autoinflammatory disorders mutations

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464765 mRNA Translation: AAL69963.1
AY154462 mRNA Translation: AAO18158.1
AC011476 Genomic DNA No translation available.
BC109125 mRNA Translation: AAI09126.1
BK001113 mRNA Translation: DAA01246.1
CCDSiCCDS12912.1 [Q8WX94-2]
CCDS33109.1 [Q8WX94-1]
CCDS46183.1 [Q8WX94-3]
RefSeqiNP_001120727.1, NM_001127255.1 [Q8WX94-3]
NP_631915.2, NM_139176.3 [Q8WX94-2]
NP_996611.2, NM_206828.3 [Q8WX94-1]
XP_006723138.1, XM_006723075.3 [Q8WX94-3]
XP_006723139.1, XM_006723076.3 [Q8WX94-3]
XP_011524901.1, XM_011526599.2 [Q8WX94-3]
UniGeneiHs.351118

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KM6NMR-A1-96[»]
ProteinModelPortaliQ8WX94
SMRiQ8WX94
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128265, 2 interactors

PTM databases

iPTMnetiQ8WX94
PhosphoSitePlusiQ8WX94

Polymorphism and mutation databases

BioMutaiNLRP7
DMDMi24212128

Proteomic databases

MaxQBiQ8WX94
PeptideAtlasiQ8WX94
PRIDEiQ8WX94
ProteomicsDBi74988
74989 [Q8WX94-2]
74990 [Q8WX94-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328092; ENSP00000329568; ENSG00000167634 [Q8WX94-2]
ENST00000340844; ENSP00000339491; ENSG00000167634 [Q8WX94-1]
ENST00000588756; ENSP00000467123; ENSG00000167634 [Q8WX94-3]
ENST00000590030; ENSP00000465520; ENSG00000167634 [Q8WX94-1]
ENST00000592784; ENSP00000468706; ENSG00000167634 [Q8WX94-3]
ENST00000610424; ENSP00000482887; ENSG00000274571 [Q8WX94-3]
ENST00000610790; ENSP00000478726; ENSG00000274571 [Q8WX94-1]
ENST00000610853; ENSP00000478890; ENSG00000274571 [Q8WX94-2]
ENST00000610981; ENSP00000479459; ENSG00000277776 [Q8WX94-3]
ENST00000611597; ENSP00000481117; ENSG00000274571 [Q8WX94-1]
ENST00000613233; ENSP00000483203; ENSG00000277776 [Q8WX94-1]
ENST00000614879; ENSP00000484444; ENSG00000277071 [Q8WX94-1]
ENST00000615426; ENSP00000484426; ENSG00000277071 [Q8WX94-3]
ENST00000615699; ENSP00000480449; ENSG00000277786 [Q8WX94-1]
ENST00000618261; ENSP00000483353; ENSG00000277179 [Q8WX94-1]
ENST00000618343; ENSP00000480226; ENSG00000274174 [Q8WX94-3]
ENST00000618672; ENSP00000481452; ENSG00000277179 [Q8WX94-3]
ENST00000618740; ENSP00000484808; ENSG00000277786 [Q8WX94-3]
ENST00000618995; ENSP00000481809; ENSG00000276804 [Q8WX94-1]
ENST00000620183; ENSP00000480034; ENSG00000274174 [Q8WX94-1]
ENST00000620820; ENSP00000482551; ENSG00000276804 [Q8WX94-3]
ENST00000621238; ENSP00000481395; ENSG00000274571 [Q8WX94-3]
ENST00000621584; ENSP00000479541; ENSG00000275483 [Q8WX94-1]
ENST00000622199; ENSP00000482194; ENSG00000275483 [Q8WX94-3]
GeneIDi199713
KEGGihsa:199713
UCSCiuc002qih.4 human [Q8WX94-1]

Organism-specific databases

CTDi199713
DisGeNETi199713
EuPathDBiHostDB:ENSG00000167634.12
GeneCardsiNLRP7
HGNCiHGNC:22947 NLRP7
HPAiHPA051382
MalaCardsiNLRP7
MIMi231090 phenotype
609661 gene
neXtProtiNX_Q8WX94
OpenTargetsiENSG00000167634
Orphaneti254688 Complete hydatidiform mole
254693 Partial hydatidiform mole
PharmGKBiPA162398003
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00900000140813
HOGENOMiHOG000294064
HOVERGENiHBG103856
InParanoidiQ8WX94
KOiK20864
OMAiDFCSLFS
OrthoDBiEOG091G01Q7
PhylomeDBiQ8WX94

Miscellaneous databases

ChiTaRSiNLRP7 human
EvolutionaryTraceiQ8WX94
GeneWikiiNLRP7
GenomeRNAii199713
PROiPR:Q8WX94
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167634 Expressed in 42 organ(s), highest expression level in female gonad
CleanExiHS_NLRP7
ExpressionAtlasiQ8WX94 baseline and differential
GenevisibleiQ8WX94 HS

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF05729 NACHT, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 2 hits
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS50837 NACHT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNALP7_HUMAN
AccessioniPrimary (citable) accession number: Q8WX94
Secondary accession number(s): E9PE16, Q32MH8, Q7RTR1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 1, 2002
Last modified: September 12, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again