Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (03 Jul 2019)
Sequence version 3 (30 Nov 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Palladin

Gene

PALLD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.3 Publications

Caution

Was wrongly assigned as myoneurin (Ref. 2).Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8WX93

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Palladin
Alternative name(s):
SIH002
Sarcoma antigen NY-SAR-77
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PALLD
Synonyms:KIAA0992
ORF Names:CGI-151
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17068 PALLD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608092 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WX93

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pancreatic cancer 1 (PNCA1)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.
Related information in OMIM
Genetic variations in PALLD may be associated with susceptibility to myocardial infarction.1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
23022

MalaCards human disease database

More...
MalaCardsi
PALLD
MIMi606856 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000129116

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1333 Familial pancreatic carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671205

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PALLD

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104206

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003027201 – 1383PalladinAdd BLAST1383

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei192PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi292 ↔ 344PROSITE-ProRule annotation
Modified residuei401PhosphoserineCombined sources1
Disulfide bondi462 ↔ 521PROSITE-ProRule annotation
Modified residuei632PhosphoserineBy similarity1
Modified residuei635PhosphothreonineBy similarity1
Modified residuei641PhosphoserineCombined sources1
Modified residuei684PhosphoserineCombined sources1
Modified residuei688PhosphoserineCombined sources1
Modified residuei728PhosphoserineCombined sources1
Modified residuei893PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Modified residuei984PhosphoserineCombined sources1
Modified residuei1101PhosphoserineCombined sources1
Modified residuei1104PhosphoserineCombined sources1
Modified residuei1106PhosphoserineCombined sources1
Modified residuei1116PhosphoserineCombined sources1
Modified residuei1118Phosphoserine; by PKB/AKT1Combined sources1 Publication1
Modified residuei1121PhosphoserineCombined sources1
Disulfide bondi1156 ↔ 1208PROSITE-ProRule annotation
Modified residuei1352PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines (By similarity). Phosphorylation at Ser-1118 by PKB/AKT1 modulates cytoskeletal organization and cell motility.By similarity2 Publications

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WX93

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WX93

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WX93

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WX93

PeptideAtlas

More...
PeptideAtlasi
Q8WX93

PRoteomics IDEntifications database

More...
PRIDEi
Q8WX93

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74979
74980 [Q8WX93-2]
74981 [Q8WX93-3]
74982 [Q8WX93-4]
74983 [Q8WX93-5]
74984 [Q8WX93-6]
74985 [Q8WX93-7]
74986 [Q8WX93-8]
74987 [Q8WX93-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WX93

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WX93

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8WX93

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT-2 and PancTu-II sporadic pancreatic cancer cell lines.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 3 is expressed de novo. Isoform 4 is up-regulated by TGFB1 during myofibroblast differentiation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129116 Expressed in 238 organ(s), highest expression level in cauda epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WX93 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WX93 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB070159
HPA035905

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EPS8 (By similarity).

Interacts with LASP1 (By similarity).

Interacts with VASP (By similarity).

Interacts with ACTN (PubMed:15147863).

Interacts with ARGBP2 (PubMed:16125169).

Interacts with PFN1 (PubMed:16367745).

Interacts with LPP (PubMed:17322171).

Interacts with SPIN90 (PubMed:17537434).

Interacts with SRC (PubMed:17537434).

Interacts with EZR (PubMed:11598191).

Interacts with RAI14 (By similarity).

By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SORBS2O948752EBI-2803991,EBI-311323

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116662, 54 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WX93, 34 interactors

Molecular INTeraction database

More...
MINTi
Q8WX93

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000425556

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11383
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WX93

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8WX93

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini271 – 360Ig-like C2-type 1Add BLAST90
Domaini440 – 539Ig-like C2-type 2Add BLAST100
Domaini1001 – 1085Ig-like C2-type 3Add BLAST85
Domaini1135 – 1226Ig-like C2-type 4Add BLAST92
Domaini1233 – 1324Ig-like C2-type 5Add BLAST92

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni562 – 566Interaction with VASPBy similarity5
Regioni646 – 676Interaction with LASP1By similarityAdd BLAST31
Regioni676 – 696Interaction with ARGBP2, SPIN90 and SRC1 PublicationAdd BLAST21
Regioni766 – 831Interaction with EPS8By similarityAdd BLAST66
Regioni796 – 831Interaction with ARGBP2, SPIN90, SRC and PFN12 PublicationsAdd BLAST36
Regioni819 – 823Interaction with VASPBy similarity5
Regioni833 – 890Interaction with ACTN1 PublicationAdd BLAST58
Regioni1137 – 1226Interaction with EZR1 PublicationAdd BLAST90
Regioni1236 – 1326Interaction with EZR1 PublicationAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi563 – 567Poly-Pro5
Compositional biasi634 – 864Pro-richAdd BLAST231

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the myotilin/palladin family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGH0 Eukaryota
ENOG41103YT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153441

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000028074

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WX93

KEGG Orthology (KO)

More...
KOi
K22029

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQFNSAE

Database of Orthologous Groups

More...
OrthoDBi
100208at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WX93

TreeFam database of animal gene trees

More...
TreeFami
TF343193

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05893 Ig_Palladin_C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR033017 Palladin_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WX93-1) [UniParc]FASTAAdd to basket
Also known as: 200-kDa

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGTSSHESF YDSLSDMQEE SKNTDFFPGL SAFLSQEEIN KSLDLARRAI
60 70 80 90 100
ADSETEDFDS EKEISQIFST SPASLCEHPS HKETKLGEHA SRRPQDNRST
110 120 130 140 150
PVQPLAEKQT KSISSPVSKR KPAMSPLLTR PSYIRSLRKA EKRGAKTPST
160 170 180 190 200
NVKPKTPHQR KGGPQSQLCD KAANLIEELT SIFKAAKPRN RSPNGESSSP
210 220 230 240 250
DSGYLSPKNQ PSALLSASAS QSPMEDQGEM EREVKSPGAR HCYQDNQDLA
260 270 280 290 300
VPHNRKSHPQ PHSALHFPAA PRFIQKLRSQ EVAEGSRVYL ECRVTGNPTP
310 320 330 340 350
RVRWFCEGKE LHNTPDIQIH CEGGDLHTLI IAEAFEDDTG RYTCLATNPS
360 370 380 390 400
GSDTTSAEVF IEGASSTDSD SESLAFKSRA GAMPQAQKKT TSVSLTIGSS
410 420 430 440 450
SPKTGVTTAV IQPLSVPVQQ VHSPTSYLCR PDGTTTAYFP PVFTKELQNT
460 470 480 490 500
AVAEGQVVVL ECRVRGAPPL QVQWFRQGSE IQDSPDFRIL QKKPRSTAEP
510 520 530 540 550
EEICTLVIAE TFPEDAGIFT CSARNDYGSA TSTAQLVVTS ANTENCSYES
560 570 580 590 600
MGESNNDHFQ HFPPPPPILE TSSLELASKK PSEIQQVNNP ELGLSRAALQ
610 620 630 640 650
MQFNAAERET NGVHPSRGVN GLINGKANSN KSLPTPAVLL SPTKEPPPLL
660 670 680 690 700
AKPKLDPLKL QQLQNQIRLE QEAGARQPPP APRSAPPSPP FPPPPAFPEL
710 720 730 740 750
AACTPPASPE PMSALASRSA PAMQSSGSFN YARPKQFIAA QNLGPASGHG
760 770 780 790 800
TPASSPSSSS LPSPMSPTPR QFGRAPVPPF AQPFGAEPEA PWGSSSPSPP
810 820 830 840 850
PPPPPVFSPT AAFPVPDVFP LPPPPPPLPS PGQASHCSSP ATRFGHSQTP
860 870 880 890 900
AAFLSALLPS QPPPAAVNAL GLPKGVTPAG FPKKASRTAR IASDEEIQGT
910 920 930 940 950
KDAVIQDLER KLRFKEDLLN NGQPRLTYEE RMARRLLGAD SATVFNIQEP
960 970 980 990 1000
EEETANQEYK VSSCEQRLIS EIEYRLERSP VDESGDEVQY GDVPVENGMA
1010 1020 1030 1040 1050
PFFEMKLKHY KIFEGMPVTF TCRVAGNPKP KIYWFKDGKQ ISPKSDHYTI
1060 1070 1080 1090 1100
QRDLDGTCSL HTTASTLDDD GNYTIMAANP QGRISCTGRL MVQAVNQRGR
1110 1120 1130 1140 1150
SPRSPSGHPH VRRPRSRSRD SGDENEPIQE RFFRPHFLQA PGDLTVQEGK
1160 1170 1180 1190 1200
LCRMDCKVSG LPTPDLSWQL DGKPVRPDSA HKMLVRENGV HSLIIEPVTS
1210 1220 1230 1240 1250
RDAGIYTCIA TNRAGQNSFS LELVVAAKEA HKPPVFIEKL QNTGVADGYP
1260 1270 1280 1290 1300
VRLECRVLGV PPPQIFWKKE NESLTHSTDR VSMHQDNHGY ICLLIQGATK
1310 1320 1330 1340 1350
EDAGWYTVSA KNEAGIVSCT ARLDVYTQWH QQSQSTKPKK VRPSASRYAA
1360 1370 1380
LSDQGLDIKA AFQPEANPSH LTLNTALVES EDL
Length:1,383
Mass (Da):150,564
Last modified:November 30, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2CABAE1A6FEE855F
GO
Isoform 2 (identifier: Q8WX93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     1326-1383: YTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → YISRH

Show »
Length:1,106
Mass (Da):122,047
Checksum:i11CC06FA94B4758B
GO
Isoform 3 (identifier: Q8WX93-3) [UniParc]FASTAAdd to basket
Also known as: 140-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.

Show »
Length:1,001
Mass (Da):108,632
Checksum:iE1A3F96F80B40B4B
GO
Isoform 4 (identifier: Q8WX93-4) [UniParc]FASTAAdd to basket
Also known as: 90-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-711: Missing.

Show »
Length:672
Mass (Da):73,322
Checksum:i94168879EA796261
GO
Isoform 5 (identifier: Q8WX93-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.

Note: No experimental confirmation available.
Show »
Length:1,159
Mass (Da):127,826
Checksum:i0B1482F9B0C36C25
GO
Isoform 6 (identifier: Q8WX93-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-1383: PEEICTLVIA...NTALVESEDL → PDVLYVFVRVRCHQMKIQYYNLAHLISSWLSSFL

Note: No experimental confirmation available.
Show »
Length:533
Mass (Da):58,796
Checksum:i608AB2AD12868576
GO
Isoform 7 (identifier: Q8WX93-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-998: Missing.

Show »
Length:385
Mass (Da):42,933
Checksum:i15853FB78B8E41B9
GO
Isoform 8 (identifier: Q8WX93-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.
     656-879: Missing.

Show »
Length:777
Mass (Da):85,894
Checksum:iD0EE5BAF3028E2BB
GO
Isoform 9 (identifier: Q8WX93-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     957-957: Q → QDIGSPHASVGSPLDGQK
     1327-1383: TQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → ISRH

Show »
Length:1,123
Mass (Da):123,693
Checksum:i12D8DFEEBE3DF2B2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y952H0Y952_HUMAN
Palladin
PALLD
512Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA05H0YA05_HUMAN
Palladin
PALLD
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISX8A0A3B3ISX8_HUMAN
Palladin
PALLD
384Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBB1D6RBB1_HUMAN
Palladin
PALLD
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBH5D6RBH5_HUMAN
Palladin
PALLD
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9Z5D6R9Z5_HUMAN
Palladin
PALLD
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R948D6R948_HUMAN
Palladin
PALLD
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WA26F8WA26_HUMAN
Palladin
PALLD
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9F5D6R9F5_HUMAN
Palladin
PALLD
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD34146 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAO65174 differs from that shown. Reason: Frameshift at positions 1150 and 1154.Curated
The sequence BAA76836 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC04796 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti277L → P in BAC04796 (PubMed:14702039).Curated1
Sequence conflicti472V → D in BAC04796 (PubMed:14702039).Curated1
Sequence conflicti611N → S in AAL69964 (Ref. 2) Curated1
Sequence conflicti847S → G in BAA76836 (PubMed:10231032).Curated1
Sequence conflicti1126E → D in AAO65174 (PubMed:12601173).Curated1
Sequence conflicti1146V → G in AAO65174 (PubMed:12601173).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034940224M → I. Corresponds to variant dbSNP:rs7671781EnsemblClinVar.1
Natural variantiVAR_059401224M → T1 PublicationCorresponds to variant dbSNP:rs7655494EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0279251 – 998Missing in isoform 7. 2 PublicationsAdd BLAST998
Alternative sequenceiVSP_0279261 – 711Missing in isoform 4. 1 PublicationAdd BLAST711
Alternative sequenceiVSP_0279271 – 382Missing in isoform 3 and isoform 8. 1 PublicationAdd BLAST382
Alternative sequenceiVSP_027928500 – 1383PEEIC…ESEDL → PDVLYVFVRVRCHQMKIQYY NLAHLISSWLSSFL in isoform 6. 1 PublicationAdd BLAST884
Alternative sequenceiVSP_027929656 – 879Missing in isoform 2, isoform 5, isoform 8 and isoform 9. 4 PublicationsAdd BLAST224
Alternative sequenceiVSP_043794957Q → QDIGSPHASVGSPLDGQK in isoform 9. 1 Publication1
Alternative sequenceiVSP_0279301326 – 1383YTQWH…ESEDL → YISRH in isoform 2. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_0437951327 – 1383TQWHQ…ESEDL → ISRH in isoform 9. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF077041 mRNA Translation: AAD27774.1
AF464873 mRNA Translation: AAL69964.1
AB023209 mRNA Translation: BAA76836.1 Different initiation.
AF151909 mRNA Translation: AAD34146.1 Different initiation.
AK095512 mRNA Translation: BAG53074.1
AK096458 mRNA Translation: BAC04796.1 Different initiation.
AC079858 Genomic DNA No translation available.
AC079926 Genomic DNA No translation available.
AC080188 Genomic DNA No translation available.
AC084353 Genomic DNA No translation available.
AC115538 Genomic DNA No translation available.
BC013867 mRNA Translation: AAH13867.2
BC144666 mRNA Translation: AAI44667.1
AY211921 mRNA Translation: AAO65174.1 Frameshift.
BX537391 mRNA Translation: CAD97633.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34098.1 [Q8WX93-2]
CCDS54818.1 [Q8WX93-9]
CCDS54819.1 [Q8WX93-8]
CCDS54820.1 [Q8WX93-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T13078

NCBI Reference Sequences

More...
RefSeqi
NP_001159580.1, NM_001166108.1 [Q8WX93-9]
NP_001159581.1, NM_001166109.1 [Q8WX93-8]
NP_001159582.1, NM_001166110.1 [Q8WX93-4]
NP_057165.3, NM_016081.3 [Q8WX93-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261509; ENSP00000261509; ENSG00000129116 [Q8WX93-2]
ENST00000505667; ENSP00000425556; ENSG00000129116 [Q8WX93-9]
ENST00000507735; ENSP00000424016; ENSG00000129116 [Q8WX93-4]
ENST00000512127; ENSP00000426947; ENSG00000129116 [Q8WX93-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23022

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23022

UCSC genome browser

More...
UCSCi
uc003iru.3 human [Q8WX93-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077041 mRNA Translation: AAD27774.1
AF464873 mRNA Translation: AAL69964.1
AB023209 mRNA Translation: BAA76836.1 Different initiation.
AF151909 mRNA Translation: AAD34146.1 Different initiation.
AK095512 mRNA Translation: BAG53074.1
AK096458 mRNA Translation: BAC04796.1 Different initiation.
AC079858 Genomic DNA No translation available.
AC079926 Genomic DNA No translation available.
AC080188 Genomic DNA No translation available.
AC084353 Genomic DNA No translation available.
AC115538 Genomic DNA No translation available.
BC013867 mRNA Translation: AAH13867.2
BC144666 mRNA Translation: AAI44667.1
AY211921 mRNA Translation: AAO65174.1 Frameshift.
BX537391 mRNA Translation: CAD97633.1
CCDSiCCDS34098.1 [Q8WX93-2]
CCDS54818.1 [Q8WX93-9]
CCDS54819.1 [Q8WX93-8]
CCDS54820.1 [Q8WX93-4]
PIRiT13078
RefSeqiNP_001159580.1, NM_001166108.1 [Q8WX93-9]
NP_001159581.1, NM_001166109.1 [Q8WX93-8]
NP_001159582.1, NM_001166110.1 [Q8WX93-4]
NP_057165.3, NM_016081.3 [Q8WX93-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DM2NMR-A1000-1096[»]
2DM3NMR-A1133-1229[»]
SMRiQ8WX93
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116662, 54 interactors
IntActiQ8WX93, 34 interactors
MINTiQ8WX93
STRINGi9606.ENSP00000425556

PTM databases

iPTMnetiQ8WX93
PhosphoSitePlusiQ8WX93
SwissPalmiQ8WX93

Polymorphism and mutation databases

BioMutaiPALLD
DMDMi313104206

Proteomic databases

EPDiQ8WX93
jPOSTiQ8WX93
MaxQBiQ8WX93
PaxDbiQ8WX93
PeptideAtlasiQ8WX93
PRIDEiQ8WX93
ProteomicsDBi74979
74980 [Q8WX93-2]
74981 [Q8WX93-3]
74982 [Q8WX93-4]
74983 [Q8WX93-5]
74984 [Q8WX93-6]
74985 [Q8WX93-7]
74986 [Q8WX93-8]
74987 [Q8WX93-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261509; ENSP00000261509; ENSG00000129116 [Q8WX93-2]
ENST00000505667; ENSP00000425556; ENSG00000129116 [Q8WX93-9]
ENST00000507735; ENSP00000424016; ENSG00000129116 [Q8WX93-4]
ENST00000512127; ENSP00000426947; ENSG00000129116 [Q8WX93-8]
GeneIDi23022
KEGGihsa:23022
UCSCiuc003iru.3 human [Q8WX93-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23022
DisGeNETi23022

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PALLD
HGNCiHGNC:17068 PALLD
HPAiCAB070159
HPA035905
MalaCardsiPALLD
MIMi606856 phenotype
608092 gene
neXtProtiNX_Q8WX93
OpenTargetsiENSG00000129116
Orphaneti1333 Familial pancreatic carcinoma
PharmGKBiPA142671205

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGH0 Eukaryota
ENOG41103YT LUCA
GeneTreeiENSGT00940000153441
HOGENOMiHOG000028074
InParanoidiQ8WX93
KOiK22029
OMAiMQFNSAE
OrthoDBi100208at2759
PhylomeDBiQ8WX93
TreeFamiTF343193

Enzyme and pathway databases

SIGNORiQ8WX93

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PALLD human
EvolutionaryTraceiQ8WX93

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Palladin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23022

Protein Ontology

More...
PROi
PR:Q8WX93

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129116 Expressed in 238 organ(s), highest expression level in cauda epididymis
ExpressionAtlasiQ8WX93 baseline and differential
GenevisibleiQ8WX93 HS

Family and domain databases

CDDicd05893 Ig_Palladin_C, 1 hit
Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR033017 Palladin_C
PfamiView protein in Pfam
PF07679 I-set, 5 hits
SMARTiView protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 5 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPALLD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WX93
Secondary accession number(s): B3KTG2
, B5MD56, B7ZMM5, Q7L3E0, Q7Z3W0, Q86WE8, Q8N1M2, Q9UGA0, Q9UQF5, Q9Y2J6, Q9Y3E9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: November 30, 2010
Last modified: July 3, 2019
This is version 162 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again