Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (12 Aug 2020)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Interleukin-1 family member 10

Gene

IL1F10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WWZ1

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9007892, Interleukin-38 signaling
R-HSA-9014826, Interleukin-36 pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-1 family member 10
Short name:
IL-1F10
Alternative name(s):
Family of interleukin 1-theta
Short name:
FIL1 theta
Interleukin-1 HY2
Short name:
IL-1HY2
Interleukin-1 theta
Short name:
IL-1 theta
Interleukin-38
Short name:
IL-38
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IL1F10
Synonyms:FIL1T, IL1HY2, IL38
ORF Names:FKSG75, UNQ6119/PRO20041
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000136697.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15552, IL1F10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615296, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WWZ1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84639

Open Targets

More...
OpenTargetsi
ENSG00000136697

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38387

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WWZ1, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IL1F10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
25008589

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001536501 – 152Interleukin-1 family member 10Add BLAST152

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WWZ1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WWZ1

PeptideAtlas

More...
PeptideAtlasi
Q8WWZ1

PRoteomics IDEntifications database

More...
PRIDEi
Q8WWZ1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74961 [Q8WWZ1-1]
74962 [Q8WWZ1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WWZ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WWZ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000136697, Expressed in skin of leg and 36 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WWZ1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000136697, Group enriched (lymphoid tissue, skin)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124164, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WWZ1, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376893

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WWZ1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1152
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WWZ1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SN3A, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182943

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_095373_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WWZ1

KEGG Orthology (KO)

More...
KOi
K05488

Identification of Orthologs from Complete Genome Data

More...
OMAi
CSLPMAK

Database of Orthologous Groups

More...
OrthoDBi
1410755at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WWZ1

TreeFam database of animal gene trees

More...
TreeFami
TF300203

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027164, IL-1_F10
IPR000975, IL-1_fam
IPR003297, IL-1RA/IL-36
IPR008996, IL1/FGF

The PANTHER Classification System

More...
PANTHERi
PTHR10078, PTHR10078, 1 hit
PTHR10078:SF29, PTHR10078:SF29, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00340, IL1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00264, INTERLEUKIN1
PR01360, INTRLEUKIN1X

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50353, SSF50353, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8WWZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCSLPMARYY IIKYADQKAL YTRDGQLLVG DPVADNCCAE KICILPNRGL
60 70 80 90 100
ARTKVPIFLG IQGGSRCLAC VETEEGPSLQ LEDVNIEELY KGGEEATRFT
110 120 130 140 150
FFQSSSGSAF RLEAAAWPGW FLCGPAEPQQ PVQLTKESEP SARTKFYFEQ

SW
Length:152
Mass (Da):16,943
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE0ABD2496551B34F
GO
Isoform 2 (identifier: Q8WWZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-39: YYIIKYADQKALYTRDGQLLVGDPVADNCCA → MSSSFLPEPLPAKSLQHGVPLSLDSSLSSLL

Show »
Length:152
Mass (Da):16,701
Checksum:i8473E8E2FC64ACCC
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01426244I → T4 PublicationsCorresponds to variant dbSNP:rs6761276Ensembl.1
Natural variantiVAR_01426351A → D4 PublicationsCorresponds to variant dbSNP:rs6743376Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0026589 – 39YYIIK…DNCCA → MSSSFLPEPLPAKSLQHGVP LSLDSSLSSLL in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY029413 mRNA Translation: AAK33010.1
AY026753 mRNA Translation: AAK01948.1
AF334755 mRNA Translation: AAK68048.1
AF334756 Genomic DNA Translation: AAK68049.1
BN000002 Genomic DNA Translation: CAD29878.1
AY358846 mRNA Translation: AAQ89205.1
AY972854 Genomic DNA Translation: AAX59032.1
AC016724 Genomic DNA Translation: AAY14991.1
BC103966 mRNA Translation: AAI03967.1
BC103967 mRNA Translation: AAI03968.1
BC103968 mRNA Translation: AAI03969.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2112.1 [Q8WWZ1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115945.4, NM_032556.5 [Q8WWZ1-1]
NP_775184.1, NM_173161.2 [Q8WWZ1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341010; ENSP00000341794; ENSG00000136697 [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697 [Q8WWZ1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84639

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84639

UCSC genome browser

More...
UCSCi
uc002tiu.4, human [Q8WWZ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029413 mRNA Translation: AAK33010.1
AY026753 mRNA Translation: AAK01948.1
AF334755 mRNA Translation: AAK68048.1
AF334756 Genomic DNA Translation: AAK68049.1
BN000002 Genomic DNA Translation: CAD29878.1
AY358846 mRNA Translation: AAQ89205.1
AY972854 Genomic DNA Translation: AAX59032.1
AC016724 Genomic DNA Translation: AAY14991.1
BC103966 mRNA Translation: AAI03967.1
BC103967 mRNA Translation: AAI03968.1
BC103968 mRNA Translation: AAI03969.1
CCDSiCCDS2112.1 [Q8WWZ1-1]
RefSeqiNP_115945.4, NM_032556.5 [Q8WWZ1-1]
NP_775184.1, NM_173161.2 [Q8WWZ1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5BOWX-ray1.31A3-152[»]
SMRiQ8WWZ1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi124164, 8 interactors
IntActiQ8WWZ1, 2 interactors
STRINGi9606.ENSP00000376893

PTM databases

iPTMnetiQ8WWZ1
PhosphoSitePlusiQ8WWZ1

Polymorphism and mutation databases

BioMutaiIL1F10
DMDMi25008589

Proteomic databases

MassIVEiQ8WWZ1
PaxDbiQ8WWZ1
PeptideAtlasiQ8WWZ1
PRIDEiQ8WWZ1
ProteomicsDBi74961 [Q8WWZ1-1]
74962 [Q8WWZ1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
47548, 175 antibodies

Genome annotation databases

EnsembliENST00000341010; ENSP00000341794; ENSG00000136697 [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697 [Q8WWZ1-1]
GeneIDi84639
KEGGihsa:84639
UCSCiuc002tiu.4, human [Q8WWZ1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84639
DisGeNETi84639
EuPathDBiHostDB:ENSG00000136697.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IL1F10
HGNCiHGNC:15552, IL1F10
HPAiENSG00000136697, Group enriched (lymphoid tissue, skin)
MIMi615296, gene
neXtProtiNX_Q8WWZ1
OpenTargetsiENSG00000136697
PharmGKBiPA38387

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502SN3A, Eukaryota
GeneTreeiENSGT00950000182943
HOGENOMiCLU_095373_2_0_1
InParanoidiQ8WWZ1
KOiK05488
OMAiCSLPMAK
OrthoDBi1410755at2759
PhylomeDBiQ8WWZ1
TreeFamiTF300203

Enzyme and pathway databases

PathwayCommonsiQ8WWZ1
ReactomeiR-HSA-9007892, Interleukin-38 signaling
R-HSA-9014826, Interleukin-36 pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84639, 5 hits in 862 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IL1F10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84639
PharosiQ8WWZ1, Tbio

Protein Ontology

More...
PROi
PR:Q8WWZ1
RNActiQ8WWZ1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000136697, Expressed in skin of leg and 36 other tissues
GenevisibleiQ8WWZ1, HS

Family and domain databases

InterProiView protein in InterPro
IPR027164, IL-1_F10
IPR000975, IL-1_fam
IPR003297, IL-1RA/IL-36
IPR008996, IL1/FGF
PANTHERiPTHR10078, PTHR10078, 1 hit
PTHR10078:SF29, PTHR10078:SF29, 1 hit
PfamiView protein in Pfam
PF00340, IL1, 1 hit
PRINTSiPR00264, INTERLEUKIN1
PR01360, INTRLEUKIN1X
SUPFAMiSSF50353, SSF50353, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIL1FA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WWZ1
Secondary accession number(s): Q53SR9
, Q56AT8, Q7RTZ5, Q969H5, Q9BYX1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: March 1, 2002
Last modified: August 12, 2020
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again