Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-1 family member 10

Gene

IL1F10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.1 Publication

GO - Molecular functioni

  • cytokine activity Source: GO_Central
  • interleukin-1 receptor binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

ReactomeiR-HSA-9007892 Interleukin-38 signaling
R-HSA-9014826 Interleukin-36 pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-1 family member 10
Short name:
IL-1F10
Alternative name(s):
Family of interleukin 1-theta
Short name:
FIL1 theta
Interleukin-1 HY2
Short name:
IL-1HY2
Interleukin-1 theta
Short name:
IL-1 theta
Interleukin-38
Short name:
IL-38
Gene namesi
Name:IL1F10
Synonyms:FIL1T, IL1HY2, IL38
ORF Names:FKSG75, UNQ6119/PRO20041
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000136697.12
HGNCiHGNC:15552 IL1F10
MIMi615296 gene
neXtProtiNX_Q8WWZ1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi84639
OpenTargetsiENSG00000136697
PharmGKBiPA38387

Polymorphism and mutation databases

BioMutaiIL1F10
DMDMi25008589

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001536501 – 152Interleukin-1 family member 10Add BLAST152

Proteomic databases

PaxDbiQ8WWZ1
PeptideAtlasiQ8WWZ1
PRIDEiQ8WWZ1
ProteomicsDBi74961
74962 [Q8WWZ1-2]

PTM databases

iPTMnetiQ8WWZ1
PhosphoSitePlusiQ8WWZ1

Expressioni

Tissue specificityi

Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.

Gene expression databases

BgeeiENSG00000136697 Expressed in 27 organ(s), highest expression level in skin of leg
CleanExiHS_IL1F10
GenevisibleiQ8WWZ1 HS

Organism-specific databases

HPAiHPA059813

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi124164, 8 interactors
IntActiQ8WWZ1, 1 interactor
STRINGi9606.ENSP00000341794

Structurei

Secondary structure

1152
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8WWZ1
SMRiQ8WWZ1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

eggNOGiENOG410IWY5 Eukaryota
ENOG41118N6 LUCA
GeneTreeiENSGT00900000141028
HOGENOMiHOG000231506
HOVERGENiHBG052099
InParanoidiQ8WWZ1
KOiK05488
OMAiAAWPGWF
OrthoDBiEOG091G0PWA
PhylomeDBiQ8WWZ1
TreeFamiTF300203

Family and domain databases

InterProiView protein in InterPro
IPR027164 IL-1_F10
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF
PANTHERiPTHR45416 PTHR45416, 1 hit
PfamiView protein in Pfam
PF00340 IL1, 1 hit
PRINTSiPR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X
SUPFAMiSSF50353 SSF50353, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8WWZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCSLPMARYY IIKYADQKAL YTRDGQLLVG DPVADNCCAE KICILPNRGL
60 70 80 90 100
ARTKVPIFLG IQGGSRCLAC VETEEGPSLQ LEDVNIEELY KGGEEATRFT
110 120 130 140 150
FFQSSSGSAF RLEAAAWPGW FLCGPAEPQQ PVQLTKESEP SARTKFYFEQ

SW
Length:152
Mass (Da):16,943
Last modified:March 1, 2002 - v1
Checksum:iE0ABD2496551B34F
GO
Isoform 2 (identifier: Q8WWZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-39: YYIIKYADQKALYTRDGQLLVGDPVADNCCA → MSSSFLPEPLPAKSLQHGVPLSLDSSLSSLL

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,701
Checksum:i8473E8E2FC64ACCC
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01426244I → T4 PublicationsCorresponds to variant dbSNP:rs6761276Ensembl.1
Natural variantiVAR_01426351A → D4 PublicationsCorresponds to variant dbSNP:rs6743376Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0026589 – 39YYIIK…DNCCA → MSSSFLPEPLPAKSLQHGVP LSLDSSLSSLL in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029413 mRNA Translation: AAK33010.1
AY026753 mRNA Translation: AAK01948.1
AF334755 mRNA Translation: AAK68048.1
AF334756 Genomic DNA Translation: AAK68049.1
BN000002 Genomic DNA Translation: CAD29878.1
AY358846 mRNA Translation: AAQ89205.1
AY972854 Genomic DNA Translation: AAX59032.1
AC016724 Genomic DNA Translation: AAY14991.1
BC103966 mRNA Translation: AAI03967.1
BC103967 mRNA Translation: AAI03968.1
BC103968 mRNA Translation: AAI03969.1
CCDSiCCDS2112.1 [Q8WWZ1-1]
RefSeqiNP_115945.4, NM_032556.5 [Q8WWZ1-1]
NP_775184.1, NM_173161.2 [Q8WWZ1-1]
UniGeneiHs.306974

Genome annotation databases

EnsembliENST00000341010; ENSP00000341794; ENSG00000136697 [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697 [Q8WWZ1-1]
GeneIDi84639
KEGGihsa:84639
UCSCiuc002tiu.4 human [Q8WWZ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029413 mRNA Translation: AAK33010.1
AY026753 mRNA Translation: AAK01948.1
AF334755 mRNA Translation: AAK68048.1
AF334756 Genomic DNA Translation: AAK68049.1
BN000002 Genomic DNA Translation: CAD29878.1
AY358846 mRNA Translation: AAQ89205.1
AY972854 Genomic DNA Translation: AAX59032.1
AC016724 Genomic DNA Translation: AAY14991.1
BC103966 mRNA Translation: AAI03967.1
BC103967 mRNA Translation: AAI03968.1
BC103968 mRNA Translation: AAI03969.1
CCDSiCCDS2112.1 [Q8WWZ1-1]
RefSeqiNP_115945.4, NM_032556.5 [Q8WWZ1-1]
NP_775184.1, NM_173161.2 [Q8WWZ1-1]
UniGeneiHs.306974

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5BOWX-ray1.31A3-152[»]
ProteinModelPortaliQ8WWZ1
SMRiQ8WWZ1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124164, 8 interactors
IntActiQ8WWZ1, 1 interactor
STRINGi9606.ENSP00000341794

PTM databases

iPTMnetiQ8WWZ1
PhosphoSitePlusiQ8WWZ1

Polymorphism and mutation databases

BioMutaiIL1F10
DMDMi25008589

Proteomic databases

PaxDbiQ8WWZ1
PeptideAtlasiQ8WWZ1
PRIDEiQ8WWZ1
ProteomicsDBi74961
74962 [Q8WWZ1-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341010; ENSP00000341794; ENSG00000136697 [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697 [Q8WWZ1-1]
GeneIDi84639
KEGGihsa:84639
UCSCiuc002tiu.4 human [Q8WWZ1-1]

Organism-specific databases

CTDi84639
DisGeNETi84639
EuPathDBiHostDB:ENSG00000136697.12
GeneCardsiIL1F10
HGNCiHGNC:15552 IL1F10
HPAiHPA059813
MIMi615296 gene
neXtProtiNX_Q8WWZ1
OpenTargetsiENSG00000136697
PharmGKBiPA38387
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWY5 Eukaryota
ENOG41118N6 LUCA
GeneTreeiENSGT00900000141028
HOGENOMiHOG000231506
HOVERGENiHBG052099
InParanoidiQ8WWZ1
KOiK05488
OMAiAAWPGWF
OrthoDBiEOG091G0PWA
PhylomeDBiQ8WWZ1
TreeFamiTF300203

Enzyme and pathway databases

ReactomeiR-HSA-9007892 Interleukin-38 signaling
R-HSA-9014826 Interleukin-36 pathway

Miscellaneous databases

GeneWikiiIL1F10
GenomeRNAii84639
PROiPR:Q8WWZ1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000136697 Expressed in 27 organ(s), highest expression level in skin of leg
CleanExiHS_IL1F10
GenevisibleiQ8WWZ1 HS

Family and domain databases

InterProiView protein in InterPro
IPR027164 IL-1_F10
IPR000975 IL-1_fam
IPR003297 IL-1RA/IL-36
IPR008996 IL1/FGF
PANTHERiPTHR45416 PTHR45416, 1 hit
PfamiView protein in Pfam
PF00340 IL1, 1 hit
PRINTSiPR00264 INTERLEUKIN1
PR01360 INTRLEUKIN1X
SUPFAMiSSF50353 SSF50353, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiIL1FA_HUMAN
AccessioniPrimary (citable) accession number: Q8WWZ1
Secondary accession number(s): Q53SR9
, Q56AT8, Q7RTZ5, Q969H5, Q9BYX1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: March 1, 2002
Last modified: November 7, 2018
This is version 133 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again