Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

U4/U6 small nuclear ribonucleoprotein Prp31

Gene

PRPF31

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in pre-mRNA splicing as component of the spliceosome (PubMed:11867543, PubMed:28781166). Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome (PubMed:11867543).2 Publications

GO - Molecular functioni

  • ribonucleoprotein complex binding Source: MGI
  • RNA binding Source: UniProtKB
  • snRNP binding Source: BHF-UCL
  • U4atac snRNA binding Source: UniProtKB
  • U4 snRNA binding Source: GO_Central

GO - Biological processi

  • mRNA splicing, via spliceosome Source: UniProtKB
  • ribonucleoprotein complex localization Source: UniProtKB
  • spliceosomal tri-snRNP complex assembly Source: MGI

Keywordsi

Molecular functionRibonucleoprotein, RNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
U4/U6 small nuclear ribonucleoprotein Prp31
Alternative name(s):
Pre-mRNA-processing factor 31
Serologically defined breast cancer antigen NY-BR-99
U4/U6 snRNP 61 kDa protein
Short name:
Protein 61K
Short name:
hPrp31
Gene namesi
Name:PRPF31
Synonyms:PRP31
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000105618.13
HGNCiHGNC:15446 PRPF31
MIMi606419 gene
neXtProtiNX_Q8WWY3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Involvement in diseasei

Retinitis pigmentosa 11 (RP11)5 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
See also OMIM:600138
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025629111 – 114Missing in RP11; high penetrance. 1 Publication4
Natural variantiVAR_025630194A → E in RP11; mislocation of the protein in the cytoplasm and reduced interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 3 PublicationsCorresponds to variant dbSNP:rs119475043EnsemblClinVar.1
Natural variantiVAR_025631216A → P in RP11; mislocation of the protein in the cytoplasm, but no effect on interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 4 PublicationsCorresponds to variant dbSNP:rs119475042EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi270H → A or K: Reduces binding to the complex formed by U4 snRNA and SNU13. 1 Publication1
Mutagenesisi351 – 364Missing : Abolishes nuclear localization. 1 PublicationAdd BLAST14

Keywords - Diseasei

Disease mutation, Retinitis pigmentosa

Organism-specific databases

DisGeNETi26121
GeneReviewsiPRPF31
MalaCardsiPRPF31
MIMi600138 phenotype
OpenTargetsiENSG00000105618
Orphaneti791 Retinitis pigmentosa
PharmGKBiPA33814

Polymorphism and mutation databases

BioMutaiPRPF31
DMDMi90101442

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002277991 – 499U4/U6 small nuclear ribonucleoprotein Prp31Add BLAST499

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei379PhosphoserineCombined sources1
Modified residuei395PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei438N6-acetyllysineBy similarity1
Modified residuei439PhosphoserineCombined sources1
Modified residuei440PhosphothreonineCombined sources1
Modified residuei450PhosphoserineCombined sources1
Modified residuei455PhosphothreonineCombined sources1
Cross-linki471Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki478Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8WWY3
MaxQBiQ8WWY3
PaxDbiQ8WWY3
PeptideAtlasiQ8WWY3
PRIDEiQ8WWY3
ProteomicsDBi74955
74956 [Q8WWY3-2]
74957 [Q8WWY3-3]

PTM databases

iPTMnetiQ8WWY3
PhosphoSitePlusiQ8WWY3

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000105618
CleanExiHS_PRPF31
ExpressionAtlasiQ8WWY3 baseline and differential
GenevisibleiQ8WWY3 HS

Organism-specific databases

HPAiHPA041939
HPA061873

Interactioni

Subunit structurei

Identified in the spliceosome B complex (PubMed:28781166). Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39 (PubMed:11867543, PubMed:16723661, PubMed:26912367). Interacts with a complex formed by SNU13 and U4 snRNA, but not with SNU13 or U4 snRNA alone (PubMed:17412961, PubMed:21784869). The complex formed by SNU13 and PRPF31 binds also U4atac snRNA, a characteristic component of specific, less abundant spliceosomal complexes (PubMed:21784869). Interacts with PRPF6/U5 snRNP-associated 102 kDa protein (PubMed:11867543, PubMed:17412961, PubMed:26912367). Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10 (PubMed:15960975). Interacts (via its NLS) with CTNNBL1 (PubMed:21385873).8 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei247Interaction with U4 snRNA1 Publication1
Sitei270Interaction with U4 snRNA and U4atac snRNA1 Publication1
Sitei289Interaction with U4atac snRNA1 Publication1
Sitei293Interaction with U4 snRNA and U4atac snRNA1 Publication1
Sitei298Interaction with U4 snRNA and U4atac snRNA1 Publication1

Binary interactionsi

WithEntry#Exp.IntActNotes
AESQ081173EBI-1567797,EBI-717810
AESQ08117-27EBI-1567797,EBI-11741437
C1QTNF1Q9BXJ13EBI-1567797,EBI-750200
C1QTNF1Q9BXJ1-25EBI-1567797,EBI-11536642
CALCOCO2Q131376EBI-1567797,EBI-739580
CCDC136Q96JN2-23EBI-1567797,EBI-10171416
CCDC57Q2TAC23EBI-1567797,EBI-2808286
CCDC57Q2TAC2-25EBI-1567797,EBI-10961624
CCNDBP1O952734EBI-1567797,EBI-748961
CDCA7LQ96GN53EBI-1567797,EBI-5278764
CDCA7LQ96GN5-23EBI-1567797,EBI-9091443
CEP70Q8NHQ18EBI-1567797,EBI-739624
EFEMP2O959675EBI-1567797,EBI-743414
FASTKQ142963EBI-1567797,EBI-1754067
GOLGA2Q0837910EBI-1567797,EBI-618309
HNRNPKP619786EBI-1567797,EBI-304185
HNRNPKP61978-27EBI-1567797,EBI-7060731
JAKMIP2Q96AA88EBI-1567797,EBI-752007
KCTD6Q8NC698EBI-1567797,EBI-2511344
KHDRBS2Q5VWX18EBI-1567797,EBI-742808
KHDRBS3O755256EBI-1567797,EBI-722504
KRT15P190128EBI-1567797,EBI-739566
KRT40Q6A1626EBI-1567797,EBI-10171697
KRTAP10-8P604108EBI-1567797,EBI-10171774
KRTAP10-9P604116EBI-1567797,EBI-10172052
LDOC1O957518EBI-1567797,EBI-740738
LURAP1Q96LR26EBI-1567797,EBI-741355
LZTS2Q9BRK43EBI-1567797,EBI-741037
MDFIQ997505EBI-1567797,EBI-724076
MID2Q9UJV3-28EBI-1567797,EBI-10172526
MIPOL1Q8TD106EBI-1567797,EBI-2548751
MKRN3Q1306410EBI-1567797,EBI-2340269
MTUS2Q5JR593EBI-1567797,EBI-742948
MTUS2Q5JR59-35EBI-1567797,EBI-11522433
NCAPH2Q6IBW43EBI-1567797,EBI-2548296
NOTCH2NLQ7Z3S96EBI-1567797,EBI-945833
PAK5Q9P2865EBI-1567797,EBI-741896
PDE4DIPQ5VU436EBI-1567797,EBI-1105124
PHC2Q8IXK03EBI-1567797,EBI-713786
PHC2Q8IXK0-53EBI-1567797,EBI-11527347
PNMA1Q8ND9010EBI-1567797,EBI-302345
PNMA2Q9UL426EBI-1567797,EBI-302355
PRICKLE1Q96MT36EBI-1567797,EBI-2348662
PRPF6O949062EBI-1567797,EBI-536755
PSTPIP1O435868EBI-1567797,EBI-1050964
RBMXP381595EBI-1567797,EBI-743526
RBMY1A1P0DJD33EBI-1567797,EBI-8638511
RBMY1A1P0DJD3-25EBI-1567797,EBI-11994018
RBMY1JQ154158EBI-1567797,EBI-8642021
SIAH1Q8IUQ43EBI-1567797,EBI-747107
SIAH1Q8IUQ4-23EBI-1567797,EBI-11522811
SSX2IPQ9Y2D86EBI-1567797,EBI-2212028
STX11O755586EBI-1567797,EBI-714135
TADA2AA0A024R0Y43EBI-1567797,EBI-11523730
TADA2AO754783EBI-1567797,EBI-742268
TFIP11Q9UBB910EBI-1567797,EBI-1105213
TMCC2O75069-46EBI-1567797,EBI-10177480
TP53BP2Q13625-33EBI-1567797,EBI-10175039
TRIM27P143738EBI-1567797,EBI-719493
TRIM41Q8WV443EBI-1567797,EBI-725997
TSGA10Q9BZW76EBI-1567797,EBI-744794
ZFP64Q9NTW73EBI-1567797,EBI-745730
ZNF24P170283EBI-1567797,EBI-707773
ZNF250P15622-36EBI-1567797,EBI-10177272
ZNF408Q9H9D43EBI-1567797,EBI-347633
ZNF417Q8TAU33EBI-1567797,EBI-740727
ZNF473Q8WTR73EBI-1567797,EBI-751409
ZNF587Q96SQ56EBI-1567797,EBI-6427977

Protein-protein interaction databases

BioGridi117563, 160 interactors
CORUMiQ8WWY3
IntActiQ8WWY3, 176 interactors
MINTiQ8WWY3
STRINGi9606.ENSP00000324122

Structurei

Secondary structure

1499
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi89 – 118Combined sources30
Turni119 – 121Combined sources3
Helixi125 – 128Combined sources4
Helixi132 – 142Combined sources11
Helixi146 – 148Combined sources3
Helixi149 – 151Combined sources3
Helixi155 – 157Combined sources3
Helixi161 – 172Combined sources12
Helixi181 – 215Combined sources35
Helixi217 – 235Combined sources19
Helixi238 – 242Combined sources5
Helixi246 – 249Combined sources4
Turni250 – 253Combined sources4
Turni273 – 276Combined sources4
Helixi278 – 281Combined sources4
Helixi285 – 287Combined sources3
Helixi288 – 307Combined sources20
Helixi315 – 331Combined sources17

3D structure databases

ProteinModelPortaliQ8WWY3
SMRiQ8WWY3
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WWY3

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini215 – 333NopPROSITE-ProRule annotationAdd BLAST119

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili85 – 1201 PublicationAdd BLAST36
Coiled coili181 – 2151 PublicationAdd BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi351 – 364Nuclear localization signal (NLS)1 PublicationAdd BLAST14

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi16 – 19Poly-Glu4
Compositional biasi25 – 29Poly-Glu5

Domaini

Interacts with the snRNP via the Nop domain.2 Publications
The coiled coil domain is formed by two non-contiguous helices.2 Publications

Sequence similaritiesi

Belongs to the PRP31 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2574 Eukaryota
COG1498 LUCA
GeneTreeiENSGT00550000075069
HOGENOMiHOG000207983
HOVERGENiHBG082193
InParanoidiQ8WWY3
KOiK12844
OMAiKVGYDLK
OrthoDBiEOG091G09U7
PhylomeDBiQ8WWY3
TreeFamiTF300677

Family and domain databases

Gene3Di1.10.287.660, 2 hits
InterProiView protein in InterPro
IPR029012 Helix_hairpin_bin_sf
IPR002687 Nop_dom
IPR036070 Nop_dom_sf
IPR012976 NOSIC
IPR027105 Prp31
IPR019175 Prp31_C
PANTHERiPTHR13904 PTHR13904, 1 hit
PfamiView protein in Pfam
PF01798 Nop, 1 hit
PF09785 Prp31_C, 1 hit
SMARTiView protein in SMART
SM00931 NOSIC, 1 hit
SUPFAMiSSF89124 SSF89124, 1 hit
PROSITEiView protein in PROSITE
PS51358 NOP, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWY3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLADELLAD LEEAAEEEEG GSYGEEEEEP AIEDVQEETQ LDLSGDSVKT
60 70 80 90 100
IAKLWDSKMF AEIMMKIEEY ISKQAKASEV MGPVEAAPEY RVIVDANNLT
110 120 130 140 150
VEIENELNII HKFIRDKYSK RFPELESLVP NALDYIRTVK ELGNSLDKCK
160 170 180 190 200
NNENLQQILT NATIMVVSVT ASTTQGQQLS EEELERLEEA CDMALELNAS
210 220 230 240 250
KHRIYEYVES RMSFIAPNLS IIIGASTAAK IMGVAGGLTN LSKMPACNIM
260 270 280 290 300
LLGAQRKTLS GFSSTSVLPH TGYIYHSDIV QSLPPDLRRK AARLVAAKCT
310 320 330 340 350
LAARVDSFHE STEGKVGYEL KDEIERKFDK WQEPPPVKQV KPLPAPLDGQ
360 370 380 390 400
RKKRGGRRYR KMKERLGLTE IRKQANRMSF GEIEEDAYQE DLGFSLGHLG
410 420 430 440 450
KSGSGRVRQT QVNEATKARI SKTLQRTLQK QSVVYGGKST IRDRSSGTAS
460 470 480 490
SVAFTPLQGL EIVNPQAAEK KVAEANQKYF SSMAEFLKVK GEKSGLMST
Length:499
Mass (Da):55,456
Last modified:March 21, 2006 - v2
Checksum:i7B50EC4C3393795C
GO
Isoform 2 (identifier: Q8WWY3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     333-364: EPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKE → RRRWLRPTRSISPAWLSSSRSRARRVALCPPE
     365-499: Missing.

Note: No experimental confirmation available.
Show »
Length:364
Mass (Da):40,779
Checksum:i799839F6D6489EEB
GO
Isoform 3 (identifier: Q8WWY3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.
     359-499: Missing.

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):30,966
Checksum:i9FCE9E591AF0B586
GO
Isoform 4 (identifier: Q8WWY3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     426-499: RTLQKQSVVY...KGEKSGLMST → VWARPRWGWG...PSPHSRAWRL

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):54,909
Checksum:i78141E2A6DB6B1FB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti188E → D in AAK77986 (PubMed:11867543).Curated1
Sequence conflicti235A → G in AAG48270 (PubMed:12747765).Curated1
Sequence conflicti244M → V in CAB43677 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025629111 – 114Missing in RP11; high penetrance. 1 Publication4
Natural variantiVAR_025630194A → E in RP11; mislocation of the protein in the cytoplasm and reduced interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 3 PublicationsCorresponds to variant dbSNP:rs119475043EnsemblClinVar.1
Natural variantiVAR_025631216A → P in RP11; mislocation of the protein in the cytoplasm, but no effect on interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 4 PublicationsCorresponds to variant dbSNP:rs119475042EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0175811 – 80Missing in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_017582333 – 364EPPPV…RKMKE → RRRWLRPTRSISPAWLSSSR SRARRVALCPPE in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_017583359 – 499Missing in isoform 3. 1 PublicationAdd BLAST141
Alternative sequenceiVSP_017584365 – 499Missing in isoform 2. 1 PublicationAdd BLAST135
Alternative sequenceiVSP_057390426 – 499RTLQK…GLMST → VWARPRWGWGPRDTRWGEPR SQPPCPPHSGPCRSRASYMA GSPPSATAPRARPPAWPSPH SRAWRL in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY040822 mRNA Translation: AAK77986.1
AF308303 mRNA Translation: AAG48270.1
AL050369 mRNA Translation: CAB43677.1
AK098547 mRNA Translation: BAC05329.1
AB593024 mRNA Translation: BAJ83978.1
AB593025 mRNA Translation: BAJ83979.1
AC012314 Genomic DNA No translation available.
AC245052 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72190.1
BC117389 mRNA Translation: AAI17390.1
CCDSiCCDS12879.1 [Q8WWY3-1]
RefSeqiNP_056444.3, NM_015629.3 [Q8WWY3-1]
XP_006723200.1, XM_006723137.3 [Q8WWY3-1]
UniGeneiHs.515598

Genome annotation databases

EnsembliENST00000321030; ENSP00000324122; ENSG00000105618 [Q8WWY3-1]
ENST00000419967; ENSP00000405166; ENSG00000105618 [Q8WWY3-4]
ENST00000610903; ENSP00000484896; ENSG00000277154 [Q8WWY3-1]
ENST00000612749; ENSP00000478804; ENSG00000276421 [Q8WWY3-4]
ENST00000613693; ENSP00000483929; ENSG00000275885 [Q8WWY3-1]
ENST00000614518; ENSP00000484151; ENSG00000274651 [Q8WWY3-4]
ENST00000615175; ENSP00000479700; ENSG00000274144 [Q8WWY3-4]
ENST00000616732; ENSP00000485017; ENSG00000276421 [Q8WWY3-1]
ENST00000618595; ENSP00000483382; ENSG00000274894 [Q8WWY3-4]
ENST00000618937; ENSP00000480434; ENSG00000274651 [Q8WWY3-1]
ENST00000619220; ENSP00000484834; ENSG00000277953 [Q8WWY3-4]
ENST00000619391; ENSP00000480636; ENSG00000275885 [Q8WWY3-4]
ENST00000619439; ENSP00000480725; ENSG00000274894 [Q8WWY3-1]
ENST00000619956; ENSP00000481201; ENSG00000275117 [Q8WWY3-1]
ENST00000620142; ENSP00000482626; ENSG00000274144 [Q8WWY3-1]
ENST00000620861; ENSP00000480726; ENSG00000277707 [Q8WWY3-1]
ENST00000621588; ENSP00000481708; ENSG00000277154 [Q8WWY3-4]
ENST00000622300; ENSP00000481654; ENSG00000277953 [Q8WWY3-1]
ENST00000622387; ENSP00000483982; ENSG00000275117 [Q8WWY3-4]
ENST00000622636; ENSP00000477787; ENSG00000277707 [Q8WWY3-4]
GeneIDi26121
KEGGihsa:26121
UCSCiuc002qdh.3 human [Q8WWY3-1]
uc061cmv.1 human

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPRP31_HUMAN
AccessioniPrimary (citable) accession number: Q8WWY3
Secondary accession number(s): E7ESA8
, F1T0A4, F1T0A5, Q17RB4, Q8N7F9, Q9H271, Q9Y439
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 21, 2006
Last modified: July 18, 2018
This is version 150 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health