Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8WWX8 (SC5AB_HUMAN)

Entry version 143 (10 Feb 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Sodium/myo-inositol cotransporter 2

Gene

SLC5A11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na+:MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.1 Publication

Miscellaneous

Acts as an autoimmune modifier in systemic lupus erythematosus (SLE) as it is significantly associated with low complement component 4 (C4), anti-Smith antibody, serositis, and alopecia.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Ion transport, Sodium transport, Sugar transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8WWX8

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-429593, Inositol transporters

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.21.3.6, the solute:sodium symporter (sss) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/myo-inositol cotransporter 2
Short name:
Na(+)/myo-inositol cotransporter 2
Alternative name(s):
Sodium-dependent glucose cotransporter
Sodium/glucose cotransporter KST1
Sodium/myo-inositol transporter 2
Short name:
SMIT2
Solute carrier family 5 member 11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC5A11Imported
Synonyms:KST11 Publication, SLGTXImported, SMIT2By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:23091, SLC5A11

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610238, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8WWX8

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000158865.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 27ExtracellularSequence analysisAdd BLAST27
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei28 – 48HelicalSequence analysisAdd BLAST21
Topological domaini49 – 65CytoplasmicSequence analysisAdd BLAST17
Transmembranei66 – 88HelicalSequence analysisAdd BLAST23
Topological domaini89 – 102ExtracellularSequence analysisAdd BLAST14
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Topological domaini124 – 135CytoplasmicSequence analysisAdd BLAST12
Transmembranei136 – 156HelicalSequence analysisAdd BLAST21
Topological domaini157 – 180ExtracellularSequence analysisAdd BLAST24
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 208CytoplasmicSequence analysis7
Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Topological domaini230 – 272ExtracellularSequence analysisAdd BLAST43
Transmembranei273 – 293HelicalSequence analysisAdd BLAST21
Topological domaini294 – 308CytoplasmicSequence analysisAdd BLAST15
Transmembranei309 – 329HelicalSequence analysisAdd BLAST21
Topological domaini330 – 375ExtracellularSequence analysisAdd BLAST46
Transmembranei376 – 396HelicalSequence analysisAdd BLAST21
Topological domaini397 – 418CytoplasmicSequence analysisAdd BLAST22
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Topological domaini440 – 446ExtracellularSequence analysis7
Transmembranei447 – 467HelicalSequence analysisAdd BLAST21
Topological domaini468 – 479CytoplasmicSequence analysisAdd BLAST12
Transmembranei480 – 500HelicalSequence analysisAdd BLAST21
Topological domaini501 – 521ExtracellularSequence analysisAdd BLAST21
Transmembranei522 – 542HelicalSequence analysisAdd BLAST21
Topological domaini543 – 654CytoplasmicSequence analysisAdd BLAST112
Transmembranei655 – 675HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		115584

Open Targets

More...OpenTargetsi		ENSG00000158865

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134923660

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8WWX8, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1744524

DrugCentral

More...DrugCentrali		Q8WWX8

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		925

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC5A11

Domain mapping of disease mutations (DMDM)

More...DMDMi		74751588

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003315681 – 675Sodium/myo-inositol cotransporter 2Add BLAST675

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8WWX8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8WWX8

PeptideAtlas

More...PeptideAtlasi		Q8WWX8

PRoteomics IDEntifications database

More...PRIDEi		Q8WWX8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		58368
6486
74950 [Q8WWX8-1]
74951 [Q8WWX8-2]
74952 [Q8WWX8-3]
74953 [Q8WWX8-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8WWX8, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8WWX8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8WWX8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in heart, skeletal muscle, kidney, liver and placenta. Weaker expression in brain, colon, spleen, lung and peripheral blood leukocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000158865, Expressed in C1 segment of cervical spinal cord and 136 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8WWX8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8WWX8, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000158865, Tissue enhanced (brain, intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		125441, 4 interactors

Protein interaction database and analysis system

More...IntActi		Q8WWX8, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000289932

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q8WWX8

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8WWX8, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. [View classification]Sequence analysis

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2349, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157690

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_018808_9_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8WWX8

Identification of Orthologs from Complete Genome Data

More...OMAi		VYTVSEM

Database of Orthologous Groups

More...OrthoDBi		243316at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8WWX8

TreeFam database of animal gene trees

More...TreeFami		TF352855

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1730.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR038377, Na/Glc_symporter_sf
IPR001734, Na/solute_symporter

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00474, SSF, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00813, sss, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50283, NA_SOLUT_SYMP_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q8WWX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESGTSSPQP PQLDPLDAFP QKGLEPGDIA VLVLYFLFVL AVGLWSTVKT 
        60         70         80         90        100
KRDTVKGYFL AGGDMVWWPV GASLFASNVG SGHFIGLAGS GAATGISVSA 
       110        120        130        140        150
YELNGLFSVL MLAWIFLPIY IAGQVTTMPE YLRKRFGGIR IPIILAVLYL 
       160        170        180        190        200
FIYIFTKISV DMYAGAIFIQ QSLHLDLYLA IVGLLAITAV YTVAGGLAAV 
       210        220        230        240        250
IYTDALQTLI MLIGALTLMG YSFAAVGGME GLKEKYFLAL ASNRSENSSC 
       260        270        280        290        300
GLPREDAFHI FRDPLTSDLP WPGVLFGMSI PSLWYWCTDQ VIVQRTLAAK 
       310        320        330        340        350
NLSHAKGGAL MAAYLKVLPL FIMVFPGMVS RILFPDQVAC ADPEICQKIC 
       360        370        380        390        400
SNPSGCSDIA YPKLVLELLP TGLRGLMMAV MVAALMSSLT SIFNSASTIF 
       410        420        430        440        450
TMDLWNHLRP RASEKELMIV GRVFVLLLVL VSILWIPVVQ ASQGGQLFIY 
       460        470        480        490        500
IQSISSYLQP PVAVVFIMGC FWKRTNEKGA FWGLISGLLL GLVRLVLDFI 
       510        520        530        540        550
YVQPRCDQPD ERPVLVKSIH YLYFSMILST VTLITVSTVS WFTEPPSKEM 
       560        570        580        590        600
VSHLTWFTRH DPVVQKEQAP PAAPLSLTLS QNGMPEASSS SSVQFEMVQE 
       610        620        630        640        650
NTSKTHSCDM TPKQSKVVKA ILWLCGIQEK GKEELPARAE AIIVSLEENP 
       660        670 
LVKTLLDVNL IFCVSCAIFI WGYFA
Length:675
Mass (Da):74,036
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i44F7BA6D2FE92335
GO
Isoform 21 Publication (identifier: Q8WWX8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-159: Missing.

Show »
Length:640
Mass (Da):69,907
Checksum:i022BC26A2571B897
GO
Isoform 31 Publication (identifier: Q8WWX8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.

Show »
Length:611
Mass (Da):67,171
Checksum:iA5B41D063A056229
GO
Isoform 4 (identifier: Q8WWX8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: W → WVGSPSVAQGTRTQWWQSWLTPASTSWAQVILSPRLPDTEEVLSTRNRLSPDTKPLGALILNFQVSRI

Show »
Length:742
Mass (Da):81,465
Checksum:iF1704416D5A1E875
GO
Isoform 5 (identifier: Q8WWX8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-104: Missing.
     125-159: Missing.

Show »
Length:605
Mass (Da):66,643
Checksum:iC6B958E973E76E6E
GO
Isoform 6 (identifier: Q8WWX8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.
     223-302: FAAVGGMEGL...VQRTLAAKNL → DCPADSGCQE...SQTRAGTPAH
     303-394: Missing.

Show »
Length:519
Mass (Da):57,098
Checksum:i8C0B47EEA9EEDE14
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BN85H3BN85_HUMAN
Sodium/myo-inositol cotransporter 2
SLC5A11
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1G0I3L1G0_HUMAN
Sodium/myo-inositol cotransporter 2
SLC5A11
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti41A → T in AAK97053 (Ref. 2) Curated1
Sequence conflicti371T → P in CAC83728 (Ref. 3) Curated1
Sequence conflicti547S → P in BAC86105 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05249447T → P. Corresponds to variant dbSNP:rs36048966Ensembl.1
Natural variantiVAR_042896182V → A Reduces serum myo-inositol concentration. 4 PublicationsCorresponds to variant dbSNP:rs11074656Ensembl.1
Natural variantiVAR_042897258F → L1 PublicationCorresponds to variant dbSNP:rs35993597Ensembl.1
Natural variantiVAR_042898452Q → R1 PublicationCorresponds to variant dbSNP:rs17854935Ensembl.1
Natural variantiVAR_042899526M → I1 Publication1
Natural variantiVAR_061877539V → M. Corresponds to variant dbSNP:rs35038575Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0527891 – 64Missing in isoform 3 and isoform 6. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_03325945W → WVGSPSVAQGTRTQWWQSWL TPASTSWAQVILSPRLPDTE EVLSTRNRLSPDTKPLGALI LNFQVSRI in isoform 4. 1 Publication1
Alternative sequenceiVSP_04503470 – 104Missing in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_052790125 – 159Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_045035223 – 302FAAVG…AAKNL → DCPADSGCQEPVPCQRRCSD GCIPEGAAPLHNGVPWDGQP HPLPRSSGLCRSRDLPEDLQ QPLRLFGHRVSQTRAGTPAH in isoform 6. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_045036303 – 394Missing in isoform 6. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY044906 mRNA Translation: AAK97784.1
AF292385 mRNA Translation: AAK97053.1
AJ305237 mRNA Translation: CAC83728.1
AK125267 mRNA Translation: BAC86105.1
AK295427 mRNA Translation: BAH12065.1
AC008731 Genomic DNA No translation available.
CH471145 Genomic DNA Translation: EAW55781.1
BC049385 mRNA Translation: AAH49385.1
BC057780 mRNA Translation: AAH57780.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10625.1 [Q8WWX8-1]
CCDS58437.1 [Q8WWX8-2]
CCDS58438.1 [Q8WWX8-5]
CCDS58439.1 [Q8WWX8-3]
CCDS58440.1 [Q8WWX8-6]

NCBI Reference Sequences

More...RefSeqi		NP_001245340.1, NM_001258411.2 [Q8WWX8-2]
NP_001245341.1, NM_001258412.2 [Q8WWX8-5]
NP_001245342.1, NM_001258413.2 [Q8WWX8-3]
NP_001245343.1, NM_001258414.1 [Q8WWX8-6]
NP_443176.2, NM_052944.4 [Q8WWX8-1]
XP_005255137.1, XM_005255080.2
XP_016878389.1, XM_017022900.1
XP_016878390.1, XM_017022901.1
XP_016878391.1, XM_017022902.1
XP_016878392.1, XM_017022903.1 [Q8WWX8-1]
XP_016878394.1, XM_017022905.1
XP_016878395.1, XM_017022906.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000347898; ENSP00000289932; ENSG00000158865 [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865 [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865 [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865 [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865 [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865 [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865 [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865 [Q8WWX8-6]
ENST00000671711; ENSP00000500525; ENSG00000288216 [Q8WWX8-6]
ENST00000672306; ENSP00000500570; ENSG00000288216 [Q8WWX8-6]
ENST00000672547; ENSP00000500395; ENSG00000288216 [Q8WWX8-2]
ENST00000672588; ENSP00000499965; ENSG00000288216 [Q8WWX8-1]
ENST00000672672; ENSP00000500207; ENSG00000288216 [Q8WWX8-5]
ENST00000672971; ENSP00000500955; ENSG00000288216 [Q8WWX8-5]
ENST00000673269; ENSP00000500384; ENSG00000288216 [Q8WWX8-2]
ENST00000673441; ENSP00000500055; ENSG00000288216 [Q8WWX8-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		115584

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:115584

UCSC genome browser

More...UCSCi		uc002dms.5, human [Q8WWX8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY044906 mRNA Translation: AAK97784.1
AF292385 mRNA Translation: AAK97053.1
AJ305237 mRNA Translation: CAC83728.1
AK125267 mRNA Translation: BAC86105.1
AK295427 mRNA Translation: BAH12065.1
AC008731 Genomic DNA No translation available.
CH471145 Genomic DNA Translation: EAW55781.1
BC049385 mRNA Translation: AAH49385.1
BC057780 mRNA Translation: AAH57780.1
CCDSiCCDS10625.1 [Q8WWX8-1]
CCDS58437.1 [Q8WWX8-2]
CCDS58438.1 [Q8WWX8-5]
CCDS58439.1 [Q8WWX8-3]
CCDS58440.1 [Q8WWX8-6]
RefSeqiNP_001245340.1, NM_001258411.2 [Q8WWX8-2]
NP_001245341.1, NM_001258412.2 [Q8WWX8-5]
NP_001245342.1, NM_001258413.2 [Q8WWX8-3]
NP_001245343.1, NM_001258414.1 [Q8WWX8-6]
NP_443176.2, NM_052944.4 [Q8WWX8-1]
XP_005255137.1, XM_005255080.2
XP_016878389.1, XM_017022900.1
XP_016878390.1, XM_017022901.1
XP_016878391.1, XM_017022902.1
XP_016878392.1, XM_017022903.1 [Q8WWX8-1]
XP_016878394.1, XM_017022905.1
XP_016878395.1, XM_017022906.1

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi125441, 4 interactors
IntActiQ8WWX8, 3 interactors
STRINGi9606.ENSP00000289932

Chemistry databases

BindingDBiQ8WWX8
ChEMBLiCHEMBL1744524
DrugCentraliQ8WWX8
GuidetoPHARMACOLOGYi925

Protein family/group databases

TCDBi2.A.21.3.6, the solute:sodium symporter (sss) family

PTM databases

GlyGeniQ8WWX8, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ8WWX8
PhosphoSitePlusiQ8WWX8

Genetic variation databases

BioMutaiSLC5A11
DMDMi74751588

Proteomic databases

MassIVEiQ8WWX8
PaxDbiQ8WWX8
PeptideAtlasiQ8WWX8
PRIDEiQ8WWX8
ProteomicsDBi58368
6486
74950 [Q8WWX8-1]
74951 [Q8WWX8-2]
74952 [Q8WWX8-3]
74953 [Q8WWX8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		12746, 136 antibodies

Genome annotation databases

EnsembliENST00000347898; ENSP00000289932; ENSG00000158865 [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865 [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865 [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865 [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865 [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865 [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865 [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865 [Q8WWX8-6]
ENST00000671711; ENSP00000500525; ENSG00000288216 [Q8WWX8-6]
ENST00000672306; ENSP00000500570; ENSG00000288216 [Q8WWX8-6]
ENST00000672547; ENSP00000500395; ENSG00000288216 [Q8WWX8-2]
ENST00000672588; ENSP00000499965; ENSG00000288216 [Q8WWX8-1]
ENST00000672672; ENSP00000500207; ENSG00000288216 [Q8WWX8-5]
ENST00000672971; ENSP00000500955; ENSG00000288216 [Q8WWX8-5]
ENST00000673269; ENSP00000500384; ENSG00000288216 [Q8WWX8-2]
ENST00000673441; ENSP00000500055; ENSG00000288216 [Q8WWX8-3]
GeneIDi115584
KEGGihsa:115584
UCSCiuc002dms.5, human [Q8WWX8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		115584
DisGeNETi115584

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC5A11
HGNCiHGNC:23091, SLC5A11
HPAiENSG00000158865, Tissue enhanced (brain, intestine)
MIMi610238, gene
neXtProtiNX_Q8WWX8
OpenTargetsiENSG00000158865
PharmGKBiPA134923660
VEuPathDBiHostDB:ENSG00000158865.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2349, Eukaryota
GeneTreeiENSGT00940000157690
HOGENOMiCLU_018808_9_2_1
InParanoidiQ8WWX8
OMAiVYTVSEM
OrthoDBi243316at2759
PhylomeDBiQ8WWX8
TreeFamiTF352855

Enzyme and pathway databases

PathwayCommonsiQ8WWX8
ReactomeiR-HSA-429593, Inositol transporters

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		115584, 3 hits in 867 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC5A11, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		115584
PharosiQ8WWX8, Tchem

Protein Ontology

More...PROi		PR:Q8WWX8
RNActiQ8WWX8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000158865, Expressed in C1 segment of cervical spinal cord and 136 other tissues
ExpressionAtlasiQ8WWX8, baseline and differential
GenevisibleiQ8WWX8, HS

Family and domain databases

Gene3Di1.20.1730.10, 1 hit
InterProiView protein in InterPro
IPR038377, Na/Glc_symporter_sf
IPR001734, Na/solute_symporter
PfamiView protein in Pfam
PF00474, SSF, 1 hit
TIGRFAMsiTIGR00813, sss, 1 hit
PROSITEiView protein in PROSITE
PS50283, NA_SOLUT_SYMP_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSC5AB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WWX8
Secondary accession number(s): B7Z329
, Q05BF1, Q6PF02, Q6ZUW3, Q86Y55, Q96PP5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: February 10, 2021
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again