Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor

Gene

FCAMR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.1 Publication

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiR-HSA-202733 Cell surface interactions at the vascular wall

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen: CD351
Gene namesi
Name:FCAMR
ORF Names:FKSG87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162897.14
HGNCiHGNC:24692 FCAMR
MIMi605484 gene
neXtProtiNX_Q8WWV6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini17 – 450ExtracellularSequence analysisAdd BLAST434
Transmembranei451 – 471HelicalSequence analysisAdd BLAST21
Topological domaini472 – 532CytoplasmicSequence analysisAdd BLAST61

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83953
PharmGKBiPA142671773

Polymorphism and mutation databases

BioMutaiFCAMR
DMDMi74760589

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000033148317 – 532High affinity immunoglobulin alpha and immunoglobulin mu Fc receptorAdd BLAST516

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi82 ↔ 153PROSITE-ProRule annotation
Glycosylationi167N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8WWV6
PeptideAtlasiQ8WWV6
PRIDEiQ8WWV6
ProteomicsDBi74940
74941 [Q8WWV6-2]
74942 [Q8WWV6-3]
74943 [Q8WWV6-4]

PTM databases

iPTMnetiQ8WWV6
PhosphoSitePlusiQ8WWV6

Expressioni

Tissue specificityi

Expressed by mesangial cells.1 Publication

Inductioni

Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

Gene expression databases

BgeeiENSG00000162897 Expressed in 33 organ(s), highest expression level in kidney epithelium
CleanExiHS_FCAMR
ExpressionAtlasiQ8WWV6 baseline and differential
GenevisibleiQ8WWV6 HS

Organism-specific databases

HPAiHPA056505

Interactioni

Protein-protein interaction databases

BioGridi123827, 1 interactor
IntActiQ8WWV6, 1 interactor
STRINGi9606.ENSP00000316491

Structurei

3D structure databases

ProteinModelPortaliQ8WWV6
SMRiQ8WWV6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 169Ig-like V-typeAdd BLAST109

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni75 – 97Mediates immunoglobulin Fc fragment-bindingBy similarityAdd BLAST23

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJ8T Eukaryota
ENOG41114ND LUCA
HOGENOMiHOG000112557
HOVERGENiHBG107915
InParanoidiQ8WWV6
KOiK16851
PhylomeDBiQ8WWV6

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL
60 70 80 90 100
CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL
110 120 130 140 150
GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC
160 170 180 190 200
YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA
210 220 230 240 250
NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG
260 270 280 290 300
SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR
310 320 330 340 350
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT
360 370 380 390 400
PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE
410 420 430 440 450
GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR
460 470 480 490 500
TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ
510 520 530
ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP
Length:532
Mass (Da):57,144
Last modified:March 1, 2002 - v1
Checksum:iD347A23C0F41EED3
GO
Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.

Note: No experimental confirmation available.
Show »
Length:220
Mass (Da):24,861
Checksum:iCF80B95E6D43E0EB
GO
Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

Note: No experimental confirmation available.
Show »
Length:534
Mass (Da):56,749
Checksum:i6EF8050E412AF91C
GO
Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Show »
Length:440
Mass (Da):46,749
Checksum:iA2F4EADB47483D25
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J1S2A0A0B4J1S2_HUMAN
High affinity immunoglobulin alpha ...
FCAMR
577Annotation score:
F8W7R9F8W7R9_HUMAN
High affinity immunoglobulin alpha ...
FCAMR
50Annotation score:

Sequence cautioni

The sequence AAI09264 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI09265 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0332271 – 11MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033228173 – 220GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_033229221 – 532Missing in isoform 2. 1 PublicationAdd BLAST312
Alternative sequenceiVSP_033230383 – 391Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_033231441 – 532Missing in isoform 4. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033232441 – 480TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA No translation available.
AY063125 mRNA Translation: AAL51154.1
AY063126 mRNA Translation: AAL51155.1
AF354295 mRNA Translation: AAK39522.1
BC109263 mRNA Translation: AAI09264.1 Different initiation.
BC109264 mRNA Translation: AAI09265.1 Different initiation.
RefSeqiNP_001116451.1, NM_001122979.2
NP_114418.2, NM_032029.4
UniGeneiHs.145519

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897
ENST00000450945; ENSP00000392707; ENSG00000162897
GeneIDi83953
KEGGihsa:83953
UCSCiuc001hfb.3 human [Q8WWV6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA No translation available.
AY063125 mRNA Translation: AAL51154.1
AY063126 mRNA Translation: AAL51155.1
AF354295 mRNA Translation: AAK39522.1
BC109263 mRNA Translation: AAI09264.1 Different initiation.
BC109264 mRNA Translation: AAI09265.1 Different initiation.
RefSeqiNP_001116451.1, NM_001122979.2
NP_114418.2, NM_032029.4
UniGeneiHs.145519

3D structure databases

ProteinModelPortaliQ8WWV6
SMRiQ8WWV6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123827, 1 interactor
IntActiQ8WWV6, 1 interactor
STRINGi9606.ENSP00000316491

PTM databases

iPTMnetiQ8WWV6
PhosphoSitePlusiQ8WWV6

Polymorphism and mutation databases

BioMutaiFCAMR
DMDMi74760589

Proteomic databases

PaxDbiQ8WWV6
PeptideAtlasiQ8WWV6
PRIDEiQ8WWV6
ProteomicsDBi74940
74941 [Q8WWV6-2]
74942 [Q8WWV6-3]
74943 [Q8WWV6-4]

Protocols and materials databases

DNASUi83953
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897
ENST00000450945; ENSP00000392707; ENSG00000162897
GeneIDi83953
KEGGihsa:83953
UCSCiuc001hfb.3 human [Q8WWV6-1]

Organism-specific databases

CTDi83953
DisGeNETi83953
EuPathDBiHostDB:ENSG00000162897.14
GeneCardsiFCAMR
HGNCiHGNC:24692 FCAMR
HPAiHPA056505
MIMi605484 gene
neXtProtiNX_Q8WWV6
PharmGKBiPA142671773
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ8T Eukaryota
ENOG41114ND LUCA
HOGENOMiHOG000112557
HOVERGENiHBG107915
InParanoidiQ8WWV6
KOiK16851
PhylomeDBiQ8WWV6

Enzyme and pathway databases

ReactomeiR-HSA-202733 Cell surface interactions at the vascular wall

Miscellaneous databases

GenomeRNAii83953
PROiPR:Q8WWV6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162897 Expressed in 33 organ(s), highest expression level in kidney epithelium
CleanExiHS_FCAMR
ExpressionAtlasiQ8WWV6 baseline and differential
GenevisibleiQ8WWV6 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFCAMR_HUMAN
AccessioniPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: September 12, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again