Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (02 Jun 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor

Gene

FCAMR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processAdaptive immunity, Immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WWV6

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-202733, Cell surface interactions at the vascular wall

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen: CD351
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FCAMR
ORF Names:FKSG87
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24692, FCAMR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605484, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WWV6

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000162897.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini17 – 450ExtracellularSequence analysisAdd BLAST434
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei451 – 471HelicalSequence analysisAdd BLAST21
Topological domaini472 – 532CytoplasmicSequence analysisAdd BLAST61

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
83953

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671773

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WWV6, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FCAMR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74760589

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000033148317 – 532High affinity immunoglobulin alpha and immunoglobulin mu Fc receptorAdd BLAST516

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi82 ↔ 153PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi167N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WWV6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WWV6

PeptideAtlas

More...
PeptideAtlasi
Q8WWV6

PRoteomics IDEntifications database

More...
PRIDEi
Q8WWV6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74940 [Q8WWV6-1]
74941 [Q8WWV6-2]
74942 [Q8WWV6-3]
74943 [Q8WWV6-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8WWV6, 5 sites, 1 O-linked glycan (4 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WWV6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WWV6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed by mesangial cells.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162897, Expressed in kidney epithelium and 52 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WWV6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WWV6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162897, Group enriched (kidney, liver, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123827, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8WWV6, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000316491

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WWV6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WWV6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini61 – 169Ig-like V-typeAdd BLAST109

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni75 – 97Mediates immunoglobulin Fc fragment-bindingBy similarityAdd BLAST23
Regioni197 – 311DisorderedSequence analysisAdd BLAST115
Regioni397 – 450DisorderedSequence analysisAdd BLAST54
Regioni508 – 532DisorderedSequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi197 – 236Polar residuesSequence analysisAdd BLAST40
Compositional biasi268 – 291Polar residuesSequence analysisAdd BLAST24
Compositional biasi292 – 311Basic and acidic residuesSequence analysisAdd BLAST20

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SNZE, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1049554_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WWV6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WWV6

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR013106, Ig_V-set

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686, V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409, IG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835, IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL
60 70 80 90 100
CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL
110 120 130 140 150
GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC
160 170 180 190 200
YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA
210 220 230 240 250
NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG
260 270 280 290 300
SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR
310 320 330 340 350
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT
360 370 380 390 400
PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE
410 420 430 440 450
GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR
460 470 480 490 500
TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ
510 520 530
ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP
Length:532
Mass (Da):57,144
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD347A23C0F41EED3
GO
Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.

Show »
Length:220
Mass (Da):24,861
Checksum:iCF80B95E6D43E0EB
GO
Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

Show »
Length:534
Mass (Da):56,749
Checksum:i6EF8050E412AF91C
GO
Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Show »
Length:440
Mass (Da):46,749
Checksum:iA2F4EADB47483D25
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J1S2A0A0B4J1S2_HUMAN
High affinity immunoglobulin alpha ...
FCAMR
577Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W7R9F8W7R9_HUMAN
High affinity immunoglobulin alpha ...
FCAMR
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI09264 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAI09265 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0332271 – 11MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033228173 – 220GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_033229221 – 532Missing in isoform 2. 1 PublicationAdd BLAST312
Alternative sequenceiVSP_033230383 – 391Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_033231441 – 532Missing in isoform 4. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033232441 – 480TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
E15470 mRNA No translation available.
AY063125 mRNA Translation: AAL51154.1
AY063126 mRNA Translation: AAL51155.1
AF354295 mRNA Translation: AAK39522.1
BC109263 mRNA Translation: AAI09264.1 Different initiation.
BC109264 mRNA Translation: AAI09265.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_001116451.1, NM_001122979.2
NP_114418.2, NM_032029.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000400962; ENSP00000383746; ENSG00000162897
ENST00000450945; ENSP00000392707; ENSG00000162897

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83953

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83953

UCSC genome browser

More...
UCSCi
uc001hfb.3, human [Q8WWV6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA No translation available.
AY063125 mRNA Translation: AAL51154.1
AY063126 mRNA Translation: AAL51155.1
AF354295 mRNA Translation: AAK39522.1
BC109263 mRNA Translation: AAI09264.1 Different initiation.
BC109264 mRNA Translation: AAI09265.1 Different initiation.
RefSeqiNP_001116451.1, NM_001122979.2
NP_114418.2, NM_032029.4

3D structure databases

SMRiQ8WWV6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123827, 1 interactor
IntActiQ8WWV6, 1 interactor
STRINGi9606.ENSP00000316491

PTM databases

GlyGeniQ8WWV6, 5 sites, 1 O-linked glycan (4 sites)
iPTMnetiQ8WWV6
PhosphoSitePlusiQ8WWV6

Genetic variation databases

BioMutaiFCAMR
DMDMi74760589

Proteomic databases

MassIVEiQ8WWV6
PaxDbiQ8WWV6
PeptideAtlasiQ8WWV6
PRIDEiQ8WWV6
ProteomicsDBi74940 [Q8WWV6-1]
74941 [Q8WWV6-2]
74942 [Q8WWV6-3]
74943 [Q8WWV6-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
57057, 53 antibodies

The DNASU plasmid repository

More...
DNASUi
83953

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897
ENST00000450945; ENSP00000392707; ENSG00000162897
GeneIDi83953
KEGGihsa:83953
UCSCiuc001hfb.3, human [Q8WWV6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83953
DisGeNETi83953

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FCAMR
HGNCiHGNC:24692, FCAMR
HPAiENSG00000162897, Group enriched (kidney, liver, lymphoid tissue)
MIMi605484, gene
neXtProtiNX_Q8WWV6
PharmGKBiPA142671773
VEuPathDBiHostDB:ENSG00000162897.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502SNZE, Eukaryota
HOGENOMiCLU_1049554_0_0_1
InParanoidiQ8WWV6
PhylomeDBiQ8WWV6

Enzyme and pathway databases

PathwayCommonsiQ8WWV6
ReactomeiR-HSA-202733, Cell surface interactions at the vascular wall

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
83953, 6 hits in 978 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83953
PharosiQ8WWV6, Tbio

Protein Ontology

More...
PROi
PR:Q8WWV6
RNActiQ8WWV6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162897, Expressed in kidney epithelium and 52 other tissues
ExpressionAtlasiQ8WWV6, baseline and differential
GenevisibleiQ8WWV6, HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR013106, Ig_V-set
PfamiView protein in Pfam
PF07686, V-set, 1 hit
SMARTiView protein in SMART
SM00409, IG, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFCAMR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: June 2, 2021
This is version 124 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again