Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (16 Oct 2019)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

T-complex protein 11 homolog

Gene

TCP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the process of sperm capacitation and acrosome reactions. Probable receptor for the putative fertilization-promoting peptide (FPP) at the sperm membrane that may modulate the activity of the adenylyl cyclase cAMP pathway.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-complex protein 11 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TCP11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11658 TCP11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
186982 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WWU5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei330 – 349HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasmic vesicle, Flagellum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000124678

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36409

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WWU5

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TCP11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74716246

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003242981 – 503T-complex protein 11 homologAdd BLAST503

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Constitutively phosphorylated on serine, threonine and tyrosine residues within the head and tail regions of noncapacitated spermatozoa. Phosphorylation on tyrosine residues increases upon sperm capacitation within the acrosomal region in a protein kinase A (PKA)-dependent signaling pathway.By similarity

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WWU5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WWU5

PeptideAtlas

More...
PeptideAtlasi
Q8WWU5

PRoteomics IDEntifications database

More...
PRIDEi
Q8WWU5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
17272
6850
6866
74933 [Q8WWU5-1]
74934 [Q8WWU5-2]
74935 [Q8WWU5-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q8WWU5-2 [Q8WWU5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WWU5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WWU5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 and isoform 3 are expressed in sperm. Isoform 1 is not detected in sperm (at protein level) (PubMed:21597245). Testis-specific (PubMed:11756566). Isoform 1, isoform 2 and isoform 3 are expressed in sperm (PubMed:21597245).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124678 Expressed in 82 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WWU5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WWU5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048311

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex at least composed of MROH2B, PRKACA isoform 2 and TCP11.

Interacts with MROH2B.

Interacts with PRKACA isoform 2 (By similarity). Isoform 2 and isoform 3 interact with ODF1 (via leucine zipper motif) (PubMed:21597245).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112814, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WWU5, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000308708

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TCP11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1981 Eukaryota
ENOG410ZDEH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161869

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231350

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WWU5

Identification of Orthologs from Complete Genome Data

More...
OMAi
FVGKLRQ

Database of Orthologous Groups

More...
OrthoDBi
1230328at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WWU5

TreeFam database of animal gene trees

More...
TreeFami
TF313385

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008862 Tcp11

The PANTHER Classification System

More...
PANTHERi
PTHR12832 PTHR12832, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05794 Tcp11, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WWU5-1) [UniParc]FASTAAdd to basket
Also known as: TCP11b1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE
60 70 80 90 100
TVNEVSKLSN KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL
110 120 130 140 150
SATPPDFSCA LELLKEIKEI LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE
160 170 180 190 200
HGALKVLYLS KYVLNMMALL CAPVRDEAVQ KLENITDPVW LLRGIFQVLG
210 220 230 240 250
RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL LNHTTKWLTQ
260 270 280 290 300
AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL
310 320 330 340 350
LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG
360 370 380 390 400
SPQFVDKLKR ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL
410 420 430 440 450
SSDNTASLMG QLQNIAKKEN CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP
460 470 480 490 500
GGLTLIEAEL AELGQKFVNL THHNQQVFGP YYTEILKTLI SPAQALETKV

ESV
Length:503
Mass (Da):56,141
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF567492970A3F68B
GO
Isoform 2 (identifier: Q8WWU5-2) [UniParc]FASTAAdd to basket
Also known as: TCP11a1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL

Show »
Length:441
Mass (Da):49,329
Checksum:i8775470FD36B5FD1
GO
Isoform 3 (identifier: Q8WWU5-3) [UniParc]FASTAAdd to basket
Also known as: TCP11c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:440
Mass (Da):49,500
Checksum:iC7D8BBBB6F1922A7
GO
Isoform 4 (identifier: Q8WWU5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV

Show »
Length:470
Mass (Da):52,445
Checksum:i2460B5E00F13D0BE
GO
Isoform 5 (identifier: Q8WWU5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
     42-47: FLSVTG → C

Show »
Length:511
Mass (Da):56,857
Checksum:iED9D2E59F08B05B1
GO
Isoform 6 (identifier: Q8WWU5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG

Show »
Length:465
Mass (Da):51,945
Checksum:iA4D107753A3D7BFE
GO
Isoform 7 (identifier: Q8WWU5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM

Note: Gene prediction based on EST data.
Show »
Length:516
Mass (Da):57,359
Checksum:i16C3FC861394C65F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9D8D6R9D8_HUMAN
T-complex protein 11 homolog
TCP11
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGY5D6RGY5_HUMAN
T-complex protein 11 homolog
TCP11
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8T8H0Y8T8_HUMAN
T-complex protein 11 homolog
TCP11
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R989D6R989_HUMAN
T-complex protein 11 homolog
TCP11
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFY8D6RFY8_HUMAN
T-complex protein 11 homolog
TCP11
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RG02D6RG02_HUMAN
T-complex protein 11 homolog
TCP11
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RIW4D6RIW4_HUMAN
T-complex protein 11 homolog
TCP11
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R8Y5D6R8Y5_HUMAN
T-complex protein 11 homolog
TCP11
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9R9D6R9R9_HUMAN
T-complex protein 11 homolog
TCP11
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAC0D6RAC0_HUMAN
T-complex protein 11 homolog
TCP11
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti157L → R in BAH13714 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039692253G → A1 PublicationCorresponds to variant dbSNP:rs2234045Ensembl.1
Natural variantiVAR_039693429R → Q. Corresponds to variant dbSNP:rs2234051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0321861 – 78MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. 3 PublicationsAdd BLAST78
Alternative sequenceiVSP_0321851 – 63Missing in isoform 3. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_0471241 – 46MPDVK…FLSVT → MTRGGGGG in isoform 6. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0452171 – 42MPDVK…DPPPF → MTRGGGGGV in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0471251M → MTRGGGGGDTISKM in isoform 5 and isoform 7. 1 Publication1
Alternative sequenceiVSP_04712642 – 47FLSVTG → C in isoform 5. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF269223 mRNA Translation: AAF75551.1
AY069943 mRNA Translation: AAL58042.1
AF260330 mRNA Translation: AAF91370.1
AF536532 mRNA Translation: AAN04044.1
AF536533 mRNA Translation: AAN04045.1
AK057234 mRNA Translation: BAG51889.1
AK301975 mRNA Translation: BAH13597.1
AK315078 mRNA Translation: BAG37546.1
AK301778 mRNA Translation: BAH13551.1
AK302022 mRNA Translation: BAH13610.1
AK302456 mRNA Translation: BAH13714.1
AL138721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03808.1
CH471081 Genomic DNA Translation: EAX03809.1
BC033729 mRNA Translation: AAH33729.1
BC040003 mRNA Translation: AAH40003.1
BC048418 mRNA Translation: AAH48418.1
BC090050 mRNA Translation: AAH90050.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47413.1 [Q8WWU5-1]
CCDS4799.1 [Q8WWU5-2]
CCDS59015.1 [Q8WWU5-3]
CCDS59016.1 [Q8WWU5-6]
CCDS59017.1 [Q8WWU5-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001087197.1, NM_001093728.2
NP_001248746.1, NM_001261817.1
NP_001248747.1, NM_001261818.1 [Q8WWU5-4]
NP_001248748.1, NM_001261819.1 [Q8WWU5-6]
NP_001248749.1, NM_001261820.1 [Q8WWU5-3]
NP_001248750.1, NM_001261821.1 [Q8WWU5-3]
NP_061149.1, NM_018679.5 [Q8WWU5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000244645; ENSP00000244645; ENSG00000124678 [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678 [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678 [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678 [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678 [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678 [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678 [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678 [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678 [Q8WWU5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6954

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6954

UCSC genome browser

More...
UCSCi
uc003ojz.3 human [Q8WWU5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF269223 mRNA Translation: AAF75551.1
AY069943 mRNA Translation: AAL58042.1
AF260330 mRNA Translation: AAF91370.1
AF536532 mRNA Translation: AAN04044.1
AF536533 mRNA Translation: AAN04045.1
AK057234 mRNA Translation: BAG51889.1
AK301975 mRNA Translation: BAH13597.1
AK315078 mRNA Translation: BAG37546.1
AK301778 mRNA Translation: BAH13551.1
AK302022 mRNA Translation: BAH13610.1
AK302456 mRNA Translation: BAH13714.1
AL138721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03808.1
CH471081 Genomic DNA Translation: EAX03809.1
BC033729 mRNA Translation: AAH33729.1
BC040003 mRNA Translation: AAH40003.1
BC048418 mRNA Translation: AAH48418.1
BC090050 mRNA Translation: AAH90050.1
CCDSiCCDS47413.1 [Q8WWU5-1]
CCDS4799.1 [Q8WWU5-2]
CCDS59015.1 [Q8WWU5-3]
CCDS59016.1 [Q8WWU5-6]
CCDS59017.1 [Q8WWU5-4]
RefSeqiNP_001087197.1, NM_001093728.2
NP_001248746.1, NM_001261817.1
NP_001248747.1, NM_001261818.1 [Q8WWU5-4]
NP_001248748.1, NM_001261819.1 [Q8WWU5-6]
NP_001248749.1, NM_001261820.1 [Q8WWU5-3]
NP_001248750.1, NM_001261821.1 [Q8WWU5-3]
NP_061149.1, NM_018679.5 [Q8WWU5-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi112814, 3 interactors
IntActiQ8WWU5, 9 interactors
STRINGi9606.ENSP00000308708

PTM databases

iPTMnetiQ8WWU5
PhosphoSitePlusiQ8WWU5

Polymorphism and mutation databases

BioMutaiTCP11
DMDMi74716246

Proteomic databases

MassIVEiQ8WWU5
PaxDbiQ8WWU5
PeptideAtlasiQ8WWU5
PRIDEiQ8WWU5
ProteomicsDBi17272
6850
6866
74933 [Q8WWU5-1]
74934 [Q8WWU5-2]
74935 [Q8WWU5-3]
TopDownProteomicsiQ8WWU5-2 [Q8WWU5-2]

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678 [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678 [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678 [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678 [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678 [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678 [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678 [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678 [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678 [Q8WWU5-3]
GeneIDi6954
KEGGihsa:6954
UCSCiuc003ojz.3 human [Q8WWU5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6954

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TCP11
HGNCiHGNC:11658 TCP11
HPAiHPA048311
MIMi186982 gene
neXtProtiNX_Q8WWU5
OpenTargetsiENSG00000124678
PharmGKBiPA36409

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1981 Eukaryota
ENOG410ZDEH LUCA
GeneTreeiENSGT00940000161869
HOGENOMiHOG000231350
InParanoidiQ8WWU5
OMAiFVGKLRQ
OrthoDBi1230328at2759
PhylomeDBiQ8WWU5
TreeFamiTF313385

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TCP11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6954
PharosiQ8WWU5

Protein Ontology

More...
PROi
PR:Q8WWU5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124678 Expressed in 82 organ(s), highest expression level in sperm
ExpressionAtlasiQ8WWU5 baseline and differential
GenevisibleiQ8WWU5 HS

Family and domain databases

InterProiView protein in InterPro
IPR008862 Tcp11
PANTHERiPTHR12832 PTHR12832, 1 hit
PfamiView protein in Pfam
PF05794 Tcp11, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTCP11_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WWU5
Secondary accession number(s): B2RCE9
, B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2002
Last modified: October 16, 2019
This is version 115 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again