Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-complex protein 11 homolog

Gene

TCP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the process of sperm capacitation and acrosome reactions. Probable receptor for the putative fertilization-promoting peptide (FPP) at the sperm membrane that may modulate the activity of the adenylyl cyclase cAMP pathway.By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
T-complex protein 11 homolog
Gene namesi
Name:TCP11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000124678.17
HGNCiHGNC:11658 TCP11
MIMi186982 gene
neXtProtiNX_Q8WWU5

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei330 – 349HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasmic vesicle, Flagellum, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000124678
PharmGKBiPA36409

Polymorphism and mutation databases

BioMutaiTCP11
DMDMi74716246

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003242981 – 503T-complex protein 11 homologAdd BLAST503

Post-translational modificationi

Constitutively phosphorylated on serine, threonine and tyrosine residues within the head and tail regions of noncapacitated spermatozoa. Phosphorylation on tyrosine residues increases upon sperm capacitation within the acrosomal region in a protein kinase A (PKA)-dependent signaling pathway.By similarity

Proteomic databases

PaxDbiQ8WWU5
PeptideAtlasiQ8WWU5
PRIDEiQ8WWU5
ProteomicsDBi74933
74934 [Q8WWU5-2]
74935 [Q8WWU5-3]
TopDownProteomicsiQ8WWU5-2 [Q8WWU5-2]

PTM databases

iPTMnetiQ8WWU5
PhosphoSitePlusiQ8WWU5

Expressioni

Tissue specificityi

Isoform 2 and isoform 3 are expressed in sperm. Isoform 1 is not detected in sperm (at protein level) (PubMed:21597245). Testis-specific (PubMed:11756566). Isoform 1, isoform 2 and isoform 3 are expressed in sperm (PubMed:21597245).2 Publications

Gene expression databases

BgeeiENSG00000124678 Expressed in 82 organ(s), highest expression level in sperm
CleanExiHS_TCP11
ExpressionAtlasiQ8WWU5 baseline and differential
GenevisibleiQ8WWU5 HS

Organism-specific databases

HPAiHPA048311

Interactioni

Subunit structurei

Found in a complex at least composed of MROH2B, PRKACA isoform 2 and TCP11. Interacts with MROH2B. Interacts with PRKACA isoform 2 (By similarity). Isoform 2 and isoform 3 interact with ODF1 (via leucine zipper motif) (PubMed:21597245).By similarity1 Publication

Protein-protein interaction databases

BioGridi112814, 3 interactors
IntActiQ8WWU5, 9 interactors
STRINGi9606.ENSP00000308708

Structurei

3D structure databases

ProteinModelPortaliQ8WWU5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TCP11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1981 Eukaryota
ENOG410ZDEH LUCA
GeneTreeiENSGT00390000008958
HOGENOMiHOG000231350
HOVERGENiHBG008348
InParanoidiQ8WWU5
OMAiLSNKIGM
OrthoDBiEOG091G07AC
PhylomeDBiQ8WWU5
TreeFamiTF313385

Family and domain databases

InterProiView protein in InterPro
IPR008862 Tcp11
PANTHERiPTHR12832 PTHR12832, 1 hit
PfamiView protein in Pfam
PF05794 Tcp11, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WWU5-1) [UniParc]FASTAAdd to basket
Also known as: TCP11b1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE
60 70 80 90 100
TVNEVSKLSN KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL
110 120 130 140 150
SATPPDFSCA LELLKEIKEI LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE
160 170 180 190 200
HGALKVLYLS KYVLNMMALL CAPVRDEAVQ KLENITDPVW LLRGIFQVLG
210 220 230 240 250
RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL LNHTTKWLTQ
260 270 280 290 300
AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL
310 320 330 340 350
LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG
360 370 380 390 400
SPQFVDKLKR ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL
410 420 430 440 450
SSDNTASLMG QLQNIAKKEN CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP
460 470 480 490 500
GGLTLIEAEL AELGQKFVNL THHNQQVFGP YYTEILKTLI SPAQALETKV

ESV
Length:503
Mass (Da):56,141
Last modified:March 1, 2002 - v1
Checksum:iF567492970A3F68B
GO
Isoform 2 (identifier: Q8WWU5-2) [UniParc]FASTAAdd to basket
Also known as: TCP11a1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL

Show »
Length:441
Mass (Da):49,329
Checksum:i8775470FD36B5FD1
GO
Isoform 3 (identifier: Q8WWU5-3) [UniParc]FASTAAdd to basket
Also known as: TCP11c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:440
Mass (Da):49,500
Checksum:iC7D8BBBB6F1922A7
GO
Isoform 4 (identifier: Q8WWU5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV

Show »
Length:470
Mass (Da):52,445
Checksum:i2460B5E00F13D0BE
GO
Isoform 5 (identifier: Q8WWU5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
     42-47: FLSVTG → C

Show »
Length:511
Mass (Da):56,857
Checksum:iED9D2E59F08B05B1
GO
Isoform 6 (identifier: Q8WWU5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG

Show »
Length:465
Mass (Da):51,945
Checksum:iA4D107753A3D7BFE
GO
Isoform 7 (identifier: Q8WWU5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM

Note: Gene prediction based on EST data.
Show »
Length:516
Mass (Da):57,359
Checksum:i16C3FC861394C65F
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y8T8H0Y8T8_HUMAN
T-complex protein 11 homolog
TCP11
245Annotation score:
D6RGY5D6RGY5_HUMAN
T-complex protein 11 homolog
TCP11
221Annotation score:
D6RAC0D6RAC0_HUMAN
T-complex protein 11 homolog
TCP11
103Annotation score:
D6R9R9D6R9R9_HUMAN
T-complex protein 11 homolog
TCP11
84Annotation score:
D6RGC0D6RGC0_HUMAN
T-complex protein 11 homolog
TCP11
69Annotation score:
D6R9D8D6R9D8_HUMAN
T-complex protein 11 homolog
TCP11
80Annotation score:
D6RG02D6RG02_HUMAN
T-complex protein 11 homolog
TCP11
41Annotation score:
D6RFY8D6RFY8_HUMAN
T-complex protein 11 homolog
TCP11
74Annotation score:
D6R8Y5D6R8Y5_HUMAN
T-complex protein 11 homolog
TCP11
89Annotation score:
D6RIW4D6RIW4_HUMAN
T-complex protein 11 homolog
TCP11
35Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti157L → R in BAH13714 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039692253G → A1 PublicationCorresponds to variant dbSNP:rs2234045Ensembl.1
Natural variantiVAR_039693429R → Q. Corresponds to variant dbSNP:rs2234051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0321861 – 78MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. 3 PublicationsAdd BLAST78
Alternative sequenceiVSP_0321851 – 63Missing in isoform 3. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_0471241 – 46MPDVK…FLSVT → MTRGGGGG in isoform 6. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0452171 – 42MPDVK…DPPPF → MTRGGGGGV in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0471251M → MTRGGGGGDTISKM in isoform 5 and isoform 7. 1 Publication1
Alternative sequenceiVSP_04712642 – 47FLSVTG → C in isoform 5. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF269223 mRNA Translation: AAF75551.1
AY069943 mRNA Translation: AAL58042.1
AF260330 mRNA Translation: AAF91370.1
AF536532 mRNA Translation: AAN04044.1
AF536533 mRNA Translation: AAN04045.1
AK057234 mRNA Translation: BAG51889.1
AK301975 mRNA Translation: BAH13597.1
AK315078 mRNA Translation: BAG37546.1
AK301778 mRNA Translation: BAH13551.1
AK302022 mRNA Translation: BAH13610.1
AK302456 mRNA Translation: BAH13714.1
AL138721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03808.1
CH471081 Genomic DNA Translation: EAX03809.1
BC033729 mRNA Translation: AAH33729.1
BC040003 mRNA Translation: AAH40003.1
BC048418 mRNA Translation: AAH48418.1
BC090050 mRNA Translation: AAH90050.1
CCDSiCCDS47413.1 [Q8WWU5-7]
CCDS4799.1 [Q8WWU5-2]
CCDS59015.1 [Q8WWU5-3]
CCDS59016.1 [Q8WWU5-6]
CCDS59017.1 [Q8WWU5-4]
CCDS59018.1 [Q8WWU5-5]
RefSeqiNP_001087197.1, NM_001093728.2 [Q8WWU5-7]
NP_001248746.1, NM_001261817.1 [Q8WWU5-5]
NP_001248747.1, NM_001261818.1 [Q8WWU5-4]
NP_001248748.1, NM_001261819.1 [Q8WWU5-6]
NP_001248749.1, NM_001261820.1 [Q8WWU5-3]
NP_001248750.1, NM_001261821.1 [Q8WWU5-3]
NP_061149.1, NM_018679.5 [Q8WWU5-2]
UniGeneiHs.435371

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678 [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678 [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678 [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678 [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678 [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678 [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678 [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678 [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678 [Q8WWU5-3]
GeneIDi6954
KEGGihsa:6954
UCSCiuc003ojz.3 human [Q8WWU5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF269223 mRNA Translation: AAF75551.1
AY069943 mRNA Translation: AAL58042.1
AF260330 mRNA Translation: AAF91370.1
AF536532 mRNA Translation: AAN04044.1
AF536533 mRNA Translation: AAN04045.1
AK057234 mRNA Translation: BAG51889.1
AK301975 mRNA Translation: BAH13597.1
AK315078 mRNA Translation: BAG37546.1
AK301778 mRNA Translation: BAH13551.1
AK302022 mRNA Translation: BAH13610.1
AK302456 mRNA Translation: BAH13714.1
AL138721 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03808.1
CH471081 Genomic DNA Translation: EAX03809.1
BC033729 mRNA Translation: AAH33729.1
BC040003 mRNA Translation: AAH40003.1
BC048418 mRNA Translation: AAH48418.1
BC090050 mRNA Translation: AAH90050.1
CCDSiCCDS47413.1 [Q8WWU5-7]
CCDS4799.1 [Q8WWU5-2]
CCDS59015.1 [Q8WWU5-3]
CCDS59016.1 [Q8WWU5-6]
CCDS59017.1 [Q8WWU5-4]
CCDS59018.1 [Q8WWU5-5]
RefSeqiNP_001087197.1, NM_001093728.2 [Q8WWU5-7]
NP_001248746.1, NM_001261817.1 [Q8WWU5-5]
NP_001248747.1, NM_001261818.1 [Q8WWU5-4]
NP_001248748.1, NM_001261819.1 [Q8WWU5-6]
NP_001248749.1, NM_001261820.1 [Q8WWU5-3]
NP_001248750.1, NM_001261821.1 [Q8WWU5-3]
NP_061149.1, NM_018679.5 [Q8WWU5-2]
UniGeneiHs.435371

3D structure databases

ProteinModelPortaliQ8WWU5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112814, 3 interactors
IntActiQ8WWU5, 9 interactors
STRINGi9606.ENSP00000308708

PTM databases

iPTMnetiQ8WWU5
PhosphoSitePlusiQ8WWU5

Polymorphism and mutation databases

BioMutaiTCP11
DMDMi74716246

Proteomic databases

PaxDbiQ8WWU5
PeptideAtlasiQ8WWU5
PRIDEiQ8WWU5
ProteomicsDBi74933
74934 [Q8WWU5-2]
74935 [Q8WWU5-3]
TopDownProteomicsiQ8WWU5-2 [Q8WWU5-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678 [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678 [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678 [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678 [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678 [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678 [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678 [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678 [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678 [Q8WWU5-3]
GeneIDi6954
KEGGihsa:6954
UCSCiuc003ojz.3 human [Q8WWU5-1]

Organism-specific databases

CTDi6954
EuPathDBiHostDB:ENSG00000124678.17
GeneCardsiTCP11
HGNCiHGNC:11658 TCP11
HPAiHPA048311
MIMi186982 gene
neXtProtiNX_Q8WWU5
OpenTargetsiENSG00000124678
PharmGKBiPA36409
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1981 Eukaryota
ENOG410ZDEH LUCA
GeneTreeiENSGT00390000008958
HOGENOMiHOG000231350
HOVERGENiHBG008348
InParanoidiQ8WWU5
OMAiLSNKIGM
OrthoDBiEOG091G07AC
PhylomeDBiQ8WWU5
TreeFamiTF313385

Miscellaneous databases

GeneWikiiTCP11
GenomeRNAii6954
PROiPR:Q8WWU5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124678 Expressed in 82 organ(s), highest expression level in sperm
CleanExiHS_TCP11
ExpressionAtlasiQ8WWU5 baseline and differential
GenevisibleiQ8WWU5 HS

Family and domain databases

InterProiView protein in InterPro
IPR008862 Tcp11
PANTHERiPTHR12832 PTHR12832, 1 hit
PfamiView protein in Pfam
PF05794 Tcp11, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTCP11_HUMAN
AccessioniPrimary (citable) accession number: Q8WWU5
Secondary accession number(s): B2RCE9
, B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2002
Last modified: November 7, 2018
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again