Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ataxin-2-like protein

Gene

ATXN2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the regulation of stress granule and P-body formation.1 Publication

GO - Molecular functioni

GO - Biological processi

  • regulation of cytoplasmic mRNA processing body assembly Source: UniProtKB
  • stress granule assembly Source: UniProtKB

Enzyme and pathway databases

SignaLinkiQ8WWM7
SIGNORiQ8WWM7

Names & Taxonomyi

Protein namesi
Recommended name:
Ataxin-2-like protein
Alternative name(s):
Ataxin-2 domain protein
Ataxin-2-related protein
Gene namesi
Name:ATXN2L
Synonyms:A2D, A2LG, A2LP, A2RP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000168488.18
HGNCiHGNC:31326 ATXN2L
MIMi607931 gene
neXtProtiNX_Q8WWM7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi361R → Q: No effect on localization to stress granules under stress conditions. 1 Publication1
Mutagenesisi370R → Q: No effect on localization to stress granules under stress conditions. 1 Publication1

Organism-specific databases

DisGeNETi11273
OpenTargetsiENSG00000168488
PharmGKBiPA128394585

Polymorphism and mutation databases

BioMutaiATXN2L
DMDMi52000729

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000647541 – 1075Ataxin-2-like proteinAdd BLAST1075

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei103PhosphoserineCombined sources1
Modified residuei111PhosphoserineCombined sources1
Modified residuei118PhosphotyrosineCombined sources1
Modified residuei207N6-acetyllysineBy similarity1
Modified residuei238PhosphoserineCombined sources1
Modified residuei264PhosphotyrosineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei309PhosphotyrosineCombined sources1
Modified residuei335PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1
Cross-linki348Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei349PhosphotyrosineCombined sources1
Modified residuei361Asymmetric dimethylarginine1 Publication1
Modified residuei391PhosphoserineCombined sources1
Modified residuei409PhosphoserineCombined sources1
Modified residuei449PhosphoserineCombined sources1
Modified residuei493PhosphoserineCombined sources1
Modified residuei496PhosphoserineCombined sources1
Modified residuei557PhosphoserineBy similarity1
Modified residuei558PhosphoserineCombined sources1
Modified residuei559PhosphoserineCombined sources1
Modified residuei563PhosphoserineCombined sources1
Modified residuei594PhosphoserineCombined sources1
Modified residuei632PhosphothreonineCombined sources1
Modified residuei634PhosphoserineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei680PhosphoserineCombined sources1
Modified residuei684PhosphoserineCombined sources1

Post-translational modificationi

Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.1 Publication
Asymmetrically dimethylated. Probably methylated by PRMT1.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8WWM7
MaxQBiQ8WWM7
PaxDbiQ8WWM7
PeptideAtlasiQ8WWM7
PRIDEiQ8WWM7
ProteomicsDBi74906
74907 [Q8WWM7-2]
74908 [Q8WWM7-3]
74909 [Q8WWM7-4]
74910 [Q8WWM7-5]
74911 [Q8WWM7-6]
74912 [Q8WWM7-7]

PTM databases

iPTMnetiQ8WWM7
PhosphoSitePlusiQ8WWM7

Miscellaneous databases

PMAP-CutDBiQ8WWM7

Expressioni

Tissue specificityi

Expressed at high levels in thymus, lymph node, spleen, fetal kidney and adult testis. Constitutively associated with MPL and EPOR in hematopoietic cells.1 Publication

Gene expression databases

BgeeiENSG00000168488 Expressed in 227 organ(s), highest expression level in testis
ExpressionAtlasiQ8WWM7 baseline and differential
GenevisibleiQ8WWM7 HS

Organism-specific databases

HPAiHPA041506
HPA043391
HPA071955

Interactioni

Subunit structurei

Interacts with MPL/TPOR and EPOR and dissociates after ligand stimulation (PubMed:11784712). Interacts with DDX6, G3BP1, and ATXN2 (PubMed:23209657). Interacts with PRMT1 (PubMed:25748791). Interacts with CIC and ATXN1 (By similarity).By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116429, 80 interactors
IntActiQ8WWM7, 44 interactors
STRINGi9606.ENSP00000378917

Structurei

3D structure databases

ProteinModelPortaliQ8WWM7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni98 – 121Interaction with MPL1 PublicationAdd BLAST24

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi4 – 84Pro-richAdd BLAST81

Sequence similaritiesi

Belongs to the ataxin-2 family.Curated

Phylogenomic databases

eggNOGiKOG2375 Eukaryota
COG5180 LUCA
GeneTreeiENSGT00530000063565
HOGENOMiHOG000234354
HOVERGENiHBG050623
InParanoidiQ8WWM7
OMAiAPPIMQA
OrthoDBiEOG091G01U5
PhylomeDBiQ8WWM7
TreeFamiTF326591

Family and domain databases

InterProiView protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX
PfamiView protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit
SMARTiView protein in SMART
SM01272 LsmAD, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WWM7-1) [UniParc]FASTAAdd to basket
Also known as: A2D-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKPQPLQQP SQPQQPPPTQ QAVARRPPGG TSPPNGGLPG PLATSAAPPG
60 70 80 90 100
PPAAASPCLG PVAAAGSGLR RGAEGILAPQ PPPPQQHQER PGAAAIGSAR
110 120 130 140 150
GQSTGKGPPQ SPVFEGVYNN SRMLHFLTAV VGSTCDVKVK NGTTYEGIFK
160 170 180 190 200
TLSSKFELAV DAVHRKASEP AGGPRREDIV DTMVFKPSDV MLVHFRNVDF
210 220 230 240 250
NYATKDKFTD SAIAMNSKVN GEHKEKVLQR WEGGDSNSDD YDLESDMSNG
260 270 280 290 300
WDPNEMFKFN EENYGVKTTY DSSLSSYTVP LEKDNSEEFR QRELRAAQLA
310 320 330 340 350
REIESSPQYR LRIAMENDDG RTEEEKHSAV QRQGSGRESP SLASREGKYI
360 370 380 390 400
PLPQRVREGP RGGVRCSSSR GGRPGLSSLP PRGPHHLDNS SPGPGSEARG
410 420 430 440 450
INGGPSRMSP KAQRPLRGAK TLSSPSNRPS GETSVPPPPA VGRMYPPRSP
460 470 480 490 500
KSAAPAPISA SCPEPPIGSA VPTSSASIPV TSSVSDPGVG SISPASPKIS
510 520 530 540 550
LAPTDVKELS TKEPGRTLEP QELARIAGKV PGLQNEQKRF QLEELRKFGA
560 570 580 590 600
QFKLQPSSSP ENSLDPFPPR ILKEEPKGKE KEVDGLLTSE PMGSPVSSKT
610 620 630 640 650
ESVSDKEDKP PLAPSGGTEG PEQPPPPCPS QTGSPPVGLI KGEDKDEGPV
660 670 680 690 700
AEQVKKSTLN PNAKEFNPTK PLLSVNKSTS TPTSPGPRTH STPSIPVLTA
710 720 730 740 750
GQSGLYSPQY ISYIPQIHMG PAVQAPQMYP YPVSNSVPGQ QGKYRGAKGS
760 770 780 790 800
LPPQRSDQHQ PASAPPMMQA AAAAGPPLVA ATPYSSYIPY NPQQFPGQPA
810 820 830 840 850
MMQPMAHYPS QPVFAPMLQS NPRMLTSGSH PQAIVSSSTP QYPSAEQPTP
860 870 880 890 900
QALYATVHQS YPHHATQLHA HQPQPATTPT GSQPQSQHAA PSPVQHQAGQ
910 920 930 940 950
APHLGSGQPQ QNLYHPGALT GTPPSLPPGP SAQSPQSSFP QPAAVYAIHH
960 970 980 990 1000
QQLPHGFTNM AHVTQAHVQT GITAAPPPHP GAPHPPQVML LHPPQSHGGP
1010 1020 1030 1040 1050
PQGAVPQSGV PALSASTPSP YPYIGHPQGE QPGQAPGFPG GADDRIREFS
1060 1070
LAGGIWHGRA EGLQVGQDAR VLGGE
Length:1,075
Mass (Da):113,374
Last modified:September 13, 2004 - v2
Checksum:i805E8B02E853C20E
GO
Isoform 2 (identifier: Q8WWM7-2) [UniParc]FASTAAdd to basket
Also known as: A2D-B

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → PPLPPPGELKIVLAAT

Show »
Length:1,062
Mass (Da):111,920
Checksum:iB054BFABDF7C093D
GO
Isoform 3 (identifier: Q8WWM7-3) [UniParc]FASTAAdd to basket
Also known as: A2D-C

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → LCRVGRSHSR...ALSDPDCLLT

Show »
Length:1,097
Mass (Da):115,582
Checksum:i34435B16C34845BD
GO
Isoform 4 (identifier: Q8WWM7-4) [UniParc]FASTAAdd to basket
Also known as: A2D-D

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → VQSHPSQQLPFHPPGN

Show »
Length:1,044
Mass (Da):110,326
Checksum:iFD514C5B1780634A
GO
Isoform 5 (identifier: Q8WWM7-5) [UniParc]FASTAAdd to basket
Also known as: A2D-E

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → APFPPPGELKIVLAAT

Show »
Length:1,044
Mass (Da):110,177
Checksum:i2EB33B345AC1E74D
GO
Isoform 6 (identifier: Q8WWM7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     896-967: HQAGQAPHLG...TNMAHVTQAH → VPAMGGAEWS...HSRICTTQGP
     968-1075: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:968
Mass (Da):102,895
Checksum:iBB93E110396C536A
GO
Isoform 7 (identifier: Q8WWM7-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-400: QRVREGPRGG...SPGPGSEARG → HRGQGQGPAG...DGRSFIFYYL
     401-1075: Missing.

Note: No experimental confirmation available.
Show »
Length:399
Mass (Da):42,995
Checksum:i1D94FCE52DE4B460
GO
Isoform 8 (identifier: Q8WWM7-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → APLPPPGELKIVLAAT

Show »
Length:1,044
Mass (Da):110,143
Checksum:i2EB33B345AC9454D
GO
Isoform 9 (identifier: Q8WWM7-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → LQSHPSQQLPFHPPGN

Show »
Length:1,062
Mass (Da):112,091
Checksum:iE5A6C8C492352F33
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BUF6H3BUF6_HUMAN
Ataxin-2-like protein
ATXN2L
1,068Annotation score:
H3BUE3H3BUE3_HUMAN
Ataxin-2-like protein
ATXN2L
217Annotation score:
A0A0C4DGL7A0A0C4DGL7_HUMAN
Ataxin-2-like protein
ATXN2L
401Annotation score:
H3BSK9H3BSK9_HUMAN
Ataxin-2-like protein
ATXN2L
336Annotation score:
H3BSQ5H3BSQ5_HUMAN
Ataxin-2-like protein
ATXN2L
91Annotation score:
H3BRB0H3BRB0_HUMAN
Ataxin-2-like protein
ATXN2L
400Annotation score:
H3BQX7H3BQX7_HUMAN
Ataxin-2-like protein
ATXN2L
128Annotation score:
H3BMX1H3BMX1_HUMAN
Ataxin-2-like protein
ATXN2L
187Annotation score:
H3BPQ7H3BPQ7_HUMAN
Ataxin-2-like protein
ATXN2L
110Annotation score:
H3BQ14H3BQ14_HUMAN
Ataxin-2-like protein
ATXN2L
11Annotation score:

Sequence cautioni

The sequence AAC69607 differs from that shown. Reason: Frameshift at positions 31, 429, 432 and 446.Curated
The sequence AAO12056 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAO12057 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAO12058 differs from that shown. Exon duplication.Curated
The sequence AAO12058 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAO12059 differs from that shown. Exon duplication.Curated
The sequence AAO12059 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAO12060 differs from that shown. Exon duplication.Curated
The sequence AAO12060 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti337R → RG in AAB19201 (PubMed:8896555).Curated1
Sequence conflicti689T → S in CAC38068 (PubMed:11784712).Curated1
Sequence conflicti689T → S in CAC38069 (PubMed:11784712).Curated1
Sequence conflicti689T → S in CAC38070 (PubMed:11784712).Curated1
Sequence conflicti689T → S in CAC38071 (PubMed:11784712).Curated1
Sequence conflicti689T → S in CAC38072 (PubMed:11784712).Curated1
Sequence conflicti726P → T in CAC38068 (PubMed:11784712).Curated1
Sequence conflicti726P → T in CAC38069 (PubMed:11784712).Curated1
Sequence conflicti726P → T in CAC38070 (PubMed:11784712).Curated1
Sequence conflicti726P → T in CAC38071 (PubMed:11784712).Curated1
Sequence conflicti726P → T in CAC38072 (PubMed:11784712).Curated1
Sequence conflicti895Q → QQ in AAH10239 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q8WWM7-2)
Sequence conflicti1049L → F in CAC38069 (PubMed:11784712).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011587354 – 400QRVRE…SEARG → HRGQGQGPAGVGGSCSAPAR PHPVLPSHPLIYSPAGDGRS FIFYYL in isoform 7. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_011588401 – 1075Missing in isoform 7. 1 PublicationAdd BLAST675
Alternative sequenceiVSP_011589896 – 967HQAGQ…VTQAH → VPAMGGAEWSWCRNGWPEEG IELGVISEWRGLGASELLAC VALNLPLPSSIRRGRPHTWA VDSHSRICTTQGP in isoform 6. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_011590968 – 1075Missing in isoform 6. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_0115911029 – 1075GEQPG…VLGGE → VQSHPSQQLPFHPPGN in isoform 4. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_0115921029 – 1075GEQPG…VLGGE → APFPPPGELKIVLAAT in isoform 5. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0442431029 – 1075GEQPG…VLGGE → APLPPPGELKIVLAAT in isoform 8. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0115931047 – 1075REFSL…VLGGE → PPLPPPGELKIVLAAT in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0115941047 – 1075REFSL…VLGGE → LCRVGRSHSRRRQGLAPGSV LCFPPSSLSCDPAAPLPTAS PALSDPDCLLT in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0471221047 – 1075REFSL…VLGGE → LQSHPSQQLPFHPPGN in isoform 9. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ317970 mRNA Translation: CAC38068.1
AJ317971 mRNA Translation: CAC38069.3
AJ317972 mRNA Translation: CAC38070.3
AJ317973 mRNA Translation: CAC38071.3
AJ317974 mRNA Translation: CAC38072.3
AY188334 mRNA Translation: AAO12056.1 Frameshift.
AY188335 mRNA Translation: AAO12057.1 Frameshift.
AY188336 mRNA Translation: AAO12058.1 Sequence problems.
AY188337 mRNA Translation: AAO12059.1 Sequence problems.
AY188338 mRNA Translation: AAO12060.1 Sequence problems.
AF034373 mRNA Translation: AAC69607.1 Frameshift.
AK289981 mRNA Translation: BAF82670.1
AC116346 Genomic DNA No translation available.
AC133550 Genomic DNA No translation available.
AC145285 Genomic DNA No translation available.
BC010239 mRNA Translation: AAH10239.1
BC068012 mRNA Translation: AAH68012.1 Sequence problems.
BC082760 mRNA Translation: AAH82760.1
BC136584 mRNA Translation: AAI36585.1
U70671 mRNA Translation: AAB19201.1
CCDSiCCDS10639.1 [Q8WWM7-4]
CCDS10640.1 [Q8WWM7-3]
CCDS10641.1 [Q8WWM7-1]
CCDS32423.1 [Q8WWM7-2]
CCDS45451.1 [Q8WWM7-8]
CCDS58443.1 [Q8WWM7-9]
RefSeqiNP_009176.2, NM_007245.3 [Q8WWM7-1]
NP_059867.3, NM_017492.3 [Q8WWM7-9]
NP_663760.1, NM_145714.2 [Q8WWM7-2]
NP_680780.1, NM_148414.2 [Q8WWM7-3]
NP_680781.1, NM_148415.2 [Q8WWM7-4]
NP_680782.1, NM_148416.2 [Q8WWM7-8]
XP_005255123.1, XM_005255066.1 [Q8WWM7-3]
UniGeneiHs.460499

Genome annotation databases

EnsembliENST00000325215; ENSP00000315650; ENSG00000168488 [Q8WWM7-2]
ENST00000336783; ENSP00000338718; ENSG00000168488 [Q8WWM7-1]
ENST00000340394; ENSP00000341459; ENSG00000168488 [Q8WWM7-4]
ENST00000382686; ENSP00000372133; ENSG00000168488 [Q8WWM7-8]
ENST00000395547; ENSP00000378917; ENSG00000168488 [Q8WWM7-3]
ENST00000570200; ENSP00000454516; ENSG00000168488 [Q8WWM7-9]
GeneIDi11273
KEGGihsa:11273
UCSCiuc002dqy.5 human [Q8WWM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ317970 mRNA Translation: CAC38068.1
AJ317971 mRNA Translation: CAC38069.3
AJ317972 mRNA Translation: CAC38070.3
AJ317973 mRNA Translation: CAC38071.3
AJ317974 mRNA Translation: CAC38072.3
AY188334 mRNA Translation: AAO12056.1 Frameshift.
AY188335 mRNA Translation: AAO12057.1 Frameshift.
AY188336 mRNA Translation: AAO12058.1 Sequence problems.
AY188337 mRNA Translation: AAO12059.1 Sequence problems.
AY188338 mRNA Translation: AAO12060.1 Sequence problems.
AF034373 mRNA Translation: AAC69607.1 Frameshift.
AK289981 mRNA Translation: BAF82670.1
AC116346 Genomic DNA No translation available.
AC133550 Genomic DNA No translation available.
AC145285 Genomic DNA No translation available.
BC010239 mRNA Translation: AAH10239.1
BC068012 mRNA Translation: AAH68012.1 Sequence problems.
BC082760 mRNA Translation: AAH82760.1
BC136584 mRNA Translation: AAI36585.1
U70671 mRNA Translation: AAB19201.1
CCDSiCCDS10639.1 [Q8WWM7-4]
CCDS10640.1 [Q8WWM7-3]
CCDS10641.1 [Q8WWM7-1]
CCDS32423.1 [Q8WWM7-2]
CCDS45451.1 [Q8WWM7-8]
CCDS58443.1 [Q8WWM7-9]
RefSeqiNP_009176.2, NM_007245.3 [Q8WWM7-1]
NP_059867.3, NM_017492.3 [Q8WWM7-9]
NP_663760.1, NM_145714.2 [Q8WWM7-2]
NP_680780.1, NM_148414.2 [Q8WWM7-3]
NP_680781.1, NM_148415.2 [Q8WWM7-4]
NP_680782.1, NM_148416.2 [Q8WWM7-8]
XP_005255123.1, XM_005255066.1 [Q8WWM7-3]
UniGeneiHs.460499

3D structure databases

ProteinModelPortaliQ8WWM7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116429, 80 interactors
IntActiQ8WWM7, 44 interactors
STRINGi9606.ENSP00000378917

PTM databases

iPTMnetiQ8WWM7
PhosphoSitePlusiQ8WWM7

Polymorphism and mutation databases

BioMutaiATXN2L
DMDMi52000729

Proteomic databases

EPDiQ8WWM7
MaxQBiQ8WWM7
PaxDbiQ8WWM7
PeptideAtlasiQ8WWM7
PRIDEiQ8WWM7
ProteomicsDBi74906
74907 [Q8WWM7-2]
74908 [Q8WWM7-3]
74909 [Q8WWM7-4]
74910 [Q8WWM7-5]
74911 [Q8WWM7-6]
74912 [Q8WWM7-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325215; ENSP00000315650; ENSG00000168488 [Q8WWM7-2]
ENST00000336783; ENSP00000338718; ENSG00000168488 [Q8WWM7-1]
ENST00000340394; ENSP00000341459; ENSG00000168488 [Q8WWM7-4]
ENST00000382686; ENSP00000372133; ENSG00000168488 [Q8WWM7-8]
ENST00000395547; ENSP00000378917; ENSG00000168488 [Q8WWM7-3]
ENST00000570200; ENSP00000454516; ENSG00000168488 [Q8WWM7-9]
GeneIDi11273
KEGGihsa:11273
UCSCiuc002dqy.5 human [Q8WWM7-1]

Organism-specific databases

CTDi11273
DisGeNETi11273
EuPathDBiHostDB:ENSG00000168488.18
GeneCardsiATXN2L
HGNCiHGNC:31326 ATXN2L
HPAiHPA041506
HPA043391
HPA071955
MIMi607931 gene
neXtProtiNX_Q8WWM7
OpenTargetsiENSG00000168488
PharmGKBiPA128394585
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2375 Eukaryota
COG5180 LUCA
GeneTreeiENSGT00530000063565
HOGENOMiHOG000234354
HOVERGENiHBG050623
InParanoidiQ8WWM7
OMAiAPPIMQA
OrthoDBiEOG091G01U5
PhylomeDBiQ8WWM7
TreeFamiTF326591

Enzyme and pathway databases

SignaLinkiQ8WWM7
SIGNORiQ8WWM7

Miscellaneous databases

GeneWikiiATXN2L
GenomeRNAii11273
PMAP-CutDBiQ8WWM7
PROiPR:Q8WWM7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168488 Expressed in 227 organ(s), highest expression level in testis
ExpressionAtlasiQ8WWM7 baseline and differential
GenevisibleiQ8WWM7 HS

Family and domain databases

InterProiView protein in InterPro
IPR009818 Ataxin-2_C
IPR009604 LsmAD_domain
IPR025852 SM_dom_ATX
PfamiView protein in Pfam
PF06741 LsmAD, 1 hit
PF07145 PAM2, 1 hit
PF14438 SM-ATX, 1 hit
SMARTiView protein in SMART
SM01272 LsmAD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiATX2L_HUMAN
AccessioniPrimary (citable) accession number: Q8WWM7
Secondary accession number(s): A8K1R6
, B9EGM2, E9PAR9, O95135, Q63ZY4, Q6NVJ8, Q6PJW6, Q8IU61, Q8IU95, Q8WWM3, Q8WWM4, Q8WWM5, Q8WWM6, Q99703
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: November 7, 2018
This is version 154 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again