Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytoskeleton-associated protein 2

Gene

CKAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Possesses microtubule stabilizing properties. Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Cell cycle

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8WWK9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytoskeleton-associated protein 2
Alternative name(s):
CTCL tumor antigen se20-10
Tumor- and microtubule-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CKAP2Imported
Synonyms:LB1Imported, TMAPImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000136108.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1990 CKAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611569 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WWK9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26586

Open Targets

More...
OpenTargetsi
ENSG00000136108

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26526

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CKAP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751579

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002457741 – 683Cytoskeleton-associated protein 2Add BLAST683

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei178PhosphoserineCombined sources1
Modified residuei190PhosphoserineCombined sources1
Modified residuei534PhosphoserineCombined sources1
Modified residuei579PhosphothreonineCombined sources1
Modified residuei582PhosphothreonineCombined sources1
Modified residuei595PhosphoserineCombined sources1
Modified residuei596PhosphothreonineCombined sources1
Modified residuei597PhosphothreonineCombined sources1
Modified residuei599PhosphotyrosineCombined sources1
Modified residuei602PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WWK9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WWK9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WWK9

PeptideAtlas

More...
PeptideAtlasi
Q8WWK9

PRoteomics IDEntifications database

More...
PRIDEi
Q8WWK9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74895

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WWK9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WWK9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Present at the G1/S boundary. Accumulates as cells progress from S to G2 into mitosis. Rapidly degraded during mitosis exit by CDH1-activated anaphase promoting complex/cyclosome (APC/C).1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in primary human gastric cancers.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000136108 Expressed in 205 organ(s), highest expression level in heart

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WWK9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WWK9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008410
HPA027821

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with alpha- and beta-tubulins.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117755, 37 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q8WWK9

Protein interaction database and analysis system

More...
IntActi
Q8WWK9, 28 interactors

Molecular INTeraction database

More...
MINTi
Q8WWK9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367276

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8WWK9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CKAP2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IF2W Eukaryota
ENOG4111T8P LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063691

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290636

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107703

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WWK9

KEGG Orthology (KO)

More...
KOi
K16769

Identification of Orthologs from Complete Genome Data

More...
OMAi
RRHTIAK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G05HU

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WWK9

TreeFam database of animal gene trees

More...
TreeFami
TF333003

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029197 CKAP2_C
IPR026165 CKAP2_fam

The PANTHER Classification System

More...
PANTHERi
PTHR16076 PTHR16076, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15297 CKAP2_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 13 Publications (identifier: Q8WWK9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTPAVPQDL QLPPSQRAQS AFKEQRRQKL KEHLLRRKTL FAYKQENEML
60 70 80 90 100
SSSRDQRVVT SEDQVQEGTK VLKLKTKMAD KENMKRPAES KNNTVVGKHC
110 120 130 140 150
IPLKPSNELT NSTVVIDTHK PKDSNQTPHL LLTEDDPQSQ HMTLSQAFHL
160 170 180 190 200
KNNSKKKQMT TEKQKQDANM PKKPVLGSYR GQIVQSKINS FRKPLQVKDE
210 220 230 240 250
SSAATKKLSA TIPKATKPQP VNTSSVTVKS NRSSNMTATT KFVSTTSQNT
260 270 280 290 300
QLVRPPIRSH HSNTRDTVKQ GISRTSANVT IRKGPHEKEL LQSKTALSSV
310 320 330 340 350
KTSSSQGIIR NKTLSRSIAS EVIARPASLS NDKLMEKSEP VDQRRHTAGK
360 370 380 390 400
AIVDSRSAQP KETSEERKAR LSEWKAGKGR VLKRPPNSVV TQHEPAGQNE
410 420 430 440 450
KPVGSFWTTM AEEDEQRLFT EKVNNTFSEC LNLINEGCPK EDILVTLNDL
460 470 480 490 500
IKNIPDAKKL VKYWICLALI EPITSPIENI IAIYEKAILA GAQPIEEMRH
510 520 530 540 550
TIVDILTMKS QEKANLGENM EKSCASKEEV KEVSIEDTGV DVDPEKLEME
560 570 580 590 600
SKLHRNLLFQ DCEKEQDNKT KDPTHDVKTP NTETRTSCLI KYNVSTTPYL
610 620 630 640 650
QSVKKKVQFD GTNSAFKELK FLTPVRRSRR LQEKTSKLPD MLKDHYPCVS
660 670 680
SLEQLTELGR ETDAFVCRPN AALCRVYYEA DTT
Length:683
Mass (Da):76,987
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i15287A7D860A4B23
GO
Isoform 2 (identifier: Q8WWK9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: Missing.
     494-495: PI → VR
     496-683: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:494
Mass (Da):55,307
Checksum:iDD773D8CC02C95B6
GO
Isoform 4 (identifier: Q8WWK9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLS → ML

Show »
Length:634
Mass (Da):71,195
Checksum:i10E49DFCE41416C5
GO
Isoform 3 (identifier: Q8WWK9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: Missing.

Note: No experimental confirmation available.
Show »
Length:682
Mass (Da):76,900
Checksum:i44F00A4FFEE1FD98
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J7Y4C9J7Y4_HUMAN
Cytoskeleton-associated protein 2
CKAP2
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J649C9J649_HUMAN
Cytoskeleton-associated protein 2
CKAP2
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG33675 differs from that shown. Reason: Frameshift at position 604.Curated
The sequence AAG33675 differs from that shown. Reason: Frameshift at position 607.Curated
The sequence AAH10901 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI05807 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA91788 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti402P → L in CAB66782 (PubMed:11230166).Curated1
Sequence conflicti531K → Q in BAA91788 (PubMed:14702039).Curated1
Sequence conflicti531K → R in BAB14345 (PubMed:14702039).Curated1
Sequence conflicti559F → L in BAB14345 (PubMed:14702039).Curated1
Sequence conflicti577V → A in BAB14345 (PubMed:14702039).Curated1
Sequence conflicti643K → R in BAA91788 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_054018236M → K1 PublicationCorresponds to variant dbSNP:rs35975899Ensembl.1
Natural variantiVAR_069359323I → V5 PublicationsCorresponds to variant dbSNP:rs7335867Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0556861 – 51MSTPA…NEMLS → ML in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_04710053Missing in isoform 2 and isoform 3. 3 Publications1
Alternative sequenceiVSP_047101494 – 495PI → VR in isoform 2. 1 Publication2
Alternative sequenceiVSP_047102496 – 683Missing in isoform 2. 1 PublicationAdd BLAST188

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y15758 mRNA Translation: CAC17466.1
AJ429398 Genomic DNA Translation: CAD22295.1
AY062261 mRNA Translation: AAL47212.1
AY062262 mRNA Translation: AAL47213.1
AK001611 mRNA Translation: BAA91788.1 Different initiation.
AK022982 mRNA Translation: BAB14345.1
AK299083 mRNA Translation: BAG61147.1
EF560732 mRNA Translation: ABQ59042.1
AL359513 Genomic DNA No translation available.
BC010901 mRNA Translation: AAH10901.1 Different initiation.
BC105806 mRNA Translation: AAI05807.1 Sequence problems.
BC130296 mRNA Translation: AAI30297.1
AF177227 mRNA Translation: AAG33675.1 Frameshift.
AL136848 mRNA Translation: CAB66782.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41893.1 [Q8WWK9-1]
CCDS66557.1 [Q8WWK9-6]
CCDS73578.1 [Q8WWK9-4]
CCDS9435.1 [Q8WWK9-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001091995.1, NM_001098525.2 [Q8WWK9-1]
NP_001273615.1, NM_001286686.1 [Q8WWK9-6]
NP_001273616.1, NM_001286687.1 [Q8WWK9-4]
NP_060674.3, NM_018204.4 [Q8WWK9-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.444028
Hs.594461

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000258607; ENSP00000258607; ENSG00000136108 [Q8WWK9-5]
ENST00000378034; ENSP00000367273; ENSG00000136108 [Q8WWK9-4]
ENST00000378037; ENSP00000367276; ENSG00000136108 [Q8WWK9-1]
ENST00000490903; ENSP00000417830; ENSG00000136108 [Q8WWK9-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26586

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26586

UCSC genome browser

More...
UCSCi
uc001vgt.4 human [Q8WWK9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15758 mRNA Translation: CAC17466.1
AJ429398 Genomic DNA Translation: CAD22295.1
AY062261 mRNA Translation: AAL47212.1
AY062262 mRNA Translation: AAL47213.1
AK001611 mRNA Translation: BAA91788.1 Different initiation.
AK022982 mRNA Translation: BAB14345.1
AK299083 mRNA Translation: BAG61147.1
EF560732 mRNA Translation: ABQ59042.1
AL359513 Genomic DNA No translation available.
BC010901 mRNA Translation: AAH10901.1 Different initiation.
BC105806 mRNA Translation: AAI05807.1 Sequence problems.
BC130296 mRNA Translation: AAI30297.1
AF177227 mRNA Translation: AAG33675.1 Frameshift.
AL136848 mRNA Translation: CAB66782.2
CCDSiCCDS41893.1 [Q8WWK9-1]
CCDS66557.1 [Q8WWK9-6]
CCDS73578.1 [Q8WWK9-4]
CCDS9435.1 [Q8WWK9-5]
RefSeqiNP_001091995.1, NM_001098525.2 [Q8WWK9-1]
NP_001273615.1, NM_001286686.1 [Q8WWK9-6]
NP_001273616.1, NM_001286687.1 [Q8WWK9-4]
NP_060674.3, NM_018204.4 [Q8WWK9-5]
UniGeneiHs.444028
Hs.594461

3D structure databases

ProteinModelPortaliQ8WWK9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117755, 37 interactors
ELMiQ8WWK9
IntActiQ8WWK9, 28 interactors
MINTiQ8WWK9
STRINGi9606.ENSP00000367276

PTM databases

iPTMnetiQ8WWK9
PhosphoSitePlusiQ8WWK9

Polymorphism and mutation databases

BioMutaiCKAP2
DMDMi74751579

Proteomic databases

EPDiQ8WWK9
MaxQBiQ8WWK9
PaxDbiQ8WWK9
PeptideAtlasiQ8WWK9
PRIDEiQ8WWK9
ProteomicsDBi74895

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
26586
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258607; ENSP00000258607; ENSG00000136108 [Q8WWK9-5]
ENST00000378034; ENSP00000367273; ENSG00000136108 [Q8WWK9-4]
ENST00000378037; ENSP00000367276; ENSG00000136108 [Q8WWK9-1]
ENST00000490903; ENSP00000417830; ENSG00000136108 [Q8WWK9-6]
GeneIDi26586
KEGGihsa:26586
UCSCiuc001vgt.4 human [Q8WWK9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26586
DisGeNETi26586
EuPathDBiHostDB:ENSG00000136108.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CKAP2
HGNCiHGNC:1990 CKAP2
HPAiHPA008410
HPA027821
MIMi611569 gene
neXtProtiNX_Q8WWK9
OpenTargetsiENSG00000136108
PharmGKBiPA26526

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IF2W Eukaryota
ENOG4111T8P LUCA
GeneTreeiENSGT00530000063691
HOGENOMiHOG000290636
HOVERGENiHBG107703
InParanoidiQ8WWK9
KOiK16769
OMAiRRHTIAK
OrthoDBiEOG091G05HU
PhylomeDBiQ8WWK9
TreeFamiTF333003

Enzyme and pathway databases

SIGNORiQ8WWK9

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CKAP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26586

Protein Ontology

More...
PROi
PR:Q8WWK9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000136108 Expressed in 205 organ(s), highest expression level in heart
ExpressionAtlasiQ8WWK9 baseline and differential
GenevisibleiQ8WWK9 HS

Family and domain databases

InterProiView protein in InterPro
IPR029197 CKAP2_C
IPR026165 CKAP2_fam
PANTHERiPTHR16076 PTHR16076, 1 hit
PfamiView protein in Pfam
PF15297 CKAP2_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCKAP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WWK9
Secondary accession number(s): A2BDE0
, A5YM58, B4DR35, E9PD90, Q3KRA5, Q5VXB4, Q8IWV5, Q8IWV6, Q96FH9, Q9H012, Q9H0D0, Q9H988, Q9HC49, Q9NVG4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: March 1, 2002
Last modified: December 5, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again