Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily A member 4

Gene

DNAJA4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi135Zinc 1By similarity1
Metal bindingi138Zinc 1By similarity1
Metal bindingi151Zinc 2By similarity1
Metal bindingi154Zinc 2By similarity1
Metal bindingi178Zinc 2By similarity1
Metal bindingi181Zinc 2By similarity1
Metal bindingi194Zinc 1By similarity1
Metal bindingi197Zinc 1By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri122 – 206CR-typeAdd BLAST85

GO - Molecular functioni

  • ATP binding Source: InterPro
  • chaperone binding Source: UniProtKB
  • heat shock protein binding Source: InterPro
  • metal ion binding Source: UniProtKB-KW
  • unfolded protein binding Source: UniProtKB

GO - Biological processi

  • negative regulation of inclusion body assembly Source: UniProtKB
  • protein refolding Source: UniProtKB
  • response to heat Source: InterPro

Keywordsi

Molecular functionChaperone
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily A member 4
Gene namesi
Name:DNAJA4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000140403.12
HGNCiHGNC:14885 DNAJA4
neXtProtiNX_Q8WW22

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi55466
OpenTargetsiENSG00000140403
PharmGKBiPA27411

Polymorphism and mutation databases

BioMutaiDNAJA4
DMDMi27805462

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710141 – 394DnaJ homolog subfamily A member 4Add BLAST394
PropeptideiPRO_0000396760395 – 397Removed in mature formBy similarity3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei18PhosphoserineCombined sources1
Modified residuei394Cysteine methyl esterBy similarity1
Lipidationi394S-farnesyl cysteineBy similarity1

Keywords - PTMi

Lipoprotein, Methylation, Phosphoprotein, Prenylation

Proteomic databases

EPDiQ8WW22
MaxQBiQ8WW22
PaxDbiQ8WW22
PeptideAtlasiQ8WW22
PRIDEiQ8WW22
ProteomicsDBi74849
74850 [Q8WW22-2]

PTM databases

iPTMnetiQ8WW22
PhosphoSitePlusiQ8WW22

Expressioni

Gene expression databases

BgeeiENSG00000140403
CleanExiHS_DNAJA4
ExpressionAtlasiQ8WW22 baseline and differential
GenevisibleiQ8WW22 HS

Organism-specific databases

HPAiCAB004646
HPA041790

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • heat shock protein binding Source: InterPro
  • unfolded protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120675, 49 interactors
IntActiQ8WW22, 23 interactors
MINTiQ8WW22
STRINGi9606.ENSP00000378324

Structurei

3D structure databases

ProteinModelPortaliQ8WW22
SMRiQ8WW22
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 70JAdd BLAST67
Repeati135 – 142CXXCXGXG motif8
Repeati151 – 158CXXCXGXG motif8
Repeati178 – 185CXXCXGXG motif8
Repeati194 – 201CXXCXGXG motif8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi75 – 96Gly-richAdd BLAST22

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri122 – 206CR-typeAdd BLAST85

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0712 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00860000133716
HOGENOMiHOG000226718
HOVERGENiHBG066727
InParanoidiQ8WW22
KOiK09505
OMAiQGQGEKF
OrthoDBiEOG091G0CAC
PhylomeDBiQ8WW22
TreeFamiTF105141

Family and domain databases

CDDicd06257 DnaJ, 1 hit
cd10719 DnaJ_zf, 1 hit
Gene3Di1.10.287.110, 1 hit
HAMAPiMF_01152 DnaJ, 1 hit
InterProiView protein in InterPro
IPR012724 DnaJ
IPR002939 DnaJ_C
IPR001623 DnaJ_domain
IPR018253 DnaJ_domain_CS
IPR008971 HSP40/DnaJ_pept-bd
IPR001305 HSP_DnaJ_Cys-rich_dom
IPR036410 HSP_DnaJ_Cys-rich_dom_sf
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF01556 DnaJ_C, 1 hit
PF00684 DnaJ_CXXCXGXG, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
SSF49493 SSF49493, 3 hits
SSF57938 SSF57938, 1 hit
PROSITEiView protein in PROSITE
PS00636 DNAJ_1, 1 hit
PS50076 DNAJ_2, 1 hit
PS51188 ZF_CR, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WW22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKETQYYDI LGVKPSASPE EIKKAYRKLA LKYHPDKNPD EGEKFKLISQ
60 70 80 90 100
AYEVLSDPKK RDVYDQGGEQ AIKEGGSGSP SFSSPMDIFD MFFGGGGRMA
110 120 130 140 150
RERRGKNVVH QLSVTLEDLY NGVTKKLALQ KNVICEKCEG VGGKKGSVEK
160 170 180 190 200
CPLCKGRGMQ IHIQQIGPGM VQQIQTVCIE CKGQGERINP KDRCESCSGA
210 220 230 240 250
KVIREKKIIE VHVEKGMKDG QKILFHGEGD QEPELEPGDV IIVLDQKDHS
260 270 280 290 300
VFQRRGHDLI MKMKIQLSEA LCGFKKTIKT LDNRILVITS KAGEVIKHGD
310 320 330 340 350
LRCVRDEGMP IYKAPLEKGI LIIQFLVIFP EKHWLSLEKL PQLEALLPPR
360 370 380 390
QKVRITDDMD QVELKEFCPN EQNWRQHREA YEEDEDGPQA GVQCQTA
Length:397
Mass (Da):44,798
Last modified:March 1, 2002 - v1
Checksum:i60D6AAD12C9B2529
GO
Isoform 2 (identifier: Q8WW22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM

Show »
Length:426
Mass (Da):47,963
Checksum:i820C0BE7F54EB221
GO
Isoform 3 (identifier: Q8WW22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK → MWESLTLDSGQISALTR

Note: No experimental confirmation available.Curated
Show »
Length:370
Mass (Da):41,597
Checksum:i3FCEABA5F96D48A2
GO

Sequence cautioni

The sequence AAH21720 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH31044 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33Y → C in BAC05229 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q8WW22-3)
Sequence conflicti1M → T in AAH31044 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069064226H → R1 PublicationCorresponds to variant dbSNP:rs17852881Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456961 – 44MVKET…DEGEK → MWESLTLDSGQISALTR in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0389651M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096616 mRNA Translation: BAC04828.1
AK098079 mRNA Translation: BAC05229.1
BX648710 mRNA Translation: CAH10558.1
AC092755 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99177.1
BC021720 mRNA Translation: AAH21720.1 Different initiation.
BC031044 mRNA Translation: AAH31044.2 Different initiation.
CCDSiCCDS10299.2 [Q8WW22-2]
CCDS45316.1 [Q8WW22-1]
CCDS45317.1 [Q8WW22-3]
RefSeqiNP_001123654.1, NM_001130182.1 [Q8WW22-1]
NP_001123655.1, NM_001130183.1 [Q8WW22-3]
NP_061072.3, NM_018602.3 [Q8WW22-2]
XP_005254592.1, XM_005254535.3 [Q8WW22-1]
XP_006720664.1, XM_006720601.1 [Q8WW22-1]
UniGeneiHs.513053

Genome annotation databases

EnsembliENST00000343789; ENSP00000339581; ENSG00000140403 [Q8WW22-1]
ENST00000394852; ENSP00000378321; ENSG00000140403 [Q8WW22-1]
ENST00000394855; ENSP00000378324; ENSG00000140403 [Q8WW22-2]
ENST00000446172; ENSP00000413499; ENSG00000140403 [Q8WW22-3]
GeneIDi55466
KEGGihsa:55466
UCSCiuc002bdi.4 human [Q8WW22-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDNJA4_HUMAN
AccessioniPrimary (citable) accession number: Q8WW22
Secondary accession number(s): E9PDM9
, Q6AW87, Q8N5Z4, Q8N7P2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: March 1, 2002
Last modified: June 20, 2018
This is version 142 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health