Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (07 Oct 2020)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

tRNA-splicing endonuclease subunit Sen15

Gene

TSEN15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini (PubMed:15109492, PubMed:27392077). There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events (PubMed:15109492).2 Publications

Caution

Although only weakly related to the S.cerevisiae SEN15 protein, it probably displays the same function within the tRNA splicing endonuclease complex.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA processing, tRNA processing

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS13020-MONOMER

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8WW01

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6784531, tRNA processing in the nucleus

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
tRNA-splicing endonuclease subunit Sen15
Alternative name(s):
SEN15 homolog
Short name:
HsSEN15
tRNA-intron endonuclease Sen15
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSEN15
Synonyms:C1orf19, SEN15
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000198860.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16791, TSEN15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608756, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WW01

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pontocerebellar hypoplasia 2F (PCH2F)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodevelopmental disorder characterized by progressive microcephaly, cognitive and motor delay, poor or absent speech, seizures, and spasticity. PCH2F inheritance is autosomal recessive.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07706176W → G in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro; may affect protein levels. 2 PublicationsCorresponds to variant dbSNP:rs730882223EnsemblClinVar.1
Natural variantiVAR_077062116H → Y in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro. 1 PublicationCorresponds to variant dbSNP:rs879253780EnsemblClinVar.1
Natural variantiVAR_077063152Y → C in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro; may affect protein levels. 1 PublicationCorresponds to variant dbSNP:rs879253779EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
116461

MalaCards human disease database

More...
MalaCardsi
TSEN15
MIMi617026, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000198860

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2524, Pontocerebellar hypoplasia type 2

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407135

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WW01, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TSEN15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50401628

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001940231 – 171tRNA-splicing endonuclease subunit Sen15Add BLAST171

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei7PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WW01

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WW01

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WW01

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WW01

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WW01

PeptideAtlas

More...
PeptideAtlasi
Q8WW01

PRoteomics IDEntifications database

More...
PRIDEi
Q8WW01

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74840 [Q8WW01-1]
74841 [Q8WW01-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WW01

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WW01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highly expressed in testis and uterus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198860, Expressed in deltoid and 215 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WW01, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WW01, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000198860, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:17166513). tRNA splicing endonuclease is a heterotetramer composed of TSEN2, TSEN15, TSEN34/LENG5 and TSEN54. tRNA splicing endonuclease complex also contains proteins of the Pre-mRNA 3' end processing machinery, such as CLP1, CPSF1, CPSF4 and CSTF2.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
125513, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8WW01

Protein interaction database and analysis system

More...
IntActi
Q8WW01, 41 interactors

Molecular INTeraction database

More...
MINTi
Q8WW01

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355299

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WW01, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1171
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q8WW01

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WW01

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8WW01

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SEN15 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S21U, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014781

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_130469_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WW01

KEGG Orthology (KO)

More...
KOi
K15324

Identification of Orthologs from Complete Genome Data

More...
OMAi
RRWKEVS

Database of Orthologous Groups

More...
OrthoDBi
1522443at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WW01

TreeFam database of animal gene trees

More...
TreeFami
TF336144

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1350.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018593, tRNA-endonuc_su_Sen15
IPR011856, tRNA_endonuc-like_dom_sf
IPR036167, tRNA_intron_Endo_cat-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09631, Sen15, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53032, SSF53032, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WW01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEERGDSEPT PGCSGLGPGG VRGFGDGGGA PSWAPEDAWM GTHPKYLEMM
60 70 80 90 100
ELDIGDATQV YVAFLVYLDL MESKSWHEVN CVGLPELQLI CLVGTEIEGE
110 120 130 140 150
GLQTVVPTPI TASLSHNRIR EILKASRKLQ GDPDLPMSFT LAIVESDSTI
160 170
VYYKLTDGFM LPDPQNISLR R
Length:171
Mass (Da):18,641
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE728BF39A89DD1FB
GO
Isoform 2 (identifier: Q8WW01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-171: REILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR → FLLEDDIHVS

Show »
Length:129
Mass (Da):13,888
Checksum:i681214969EA67A76
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2U3TZM3A0A2U3TZM3_HUMAN
Chromosome 1 open reading frame 19,...
TSEN15 C1orf19, hCG_40901
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPN1E9PPN1_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCV5H0YCV5_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3M0F2Z3M0_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6A4A0A2R8Y6A4_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
183Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YDU8A0A2R8YDU8_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6B3A0A2R8Y6B3_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6M5A0A2R8Y6M5_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7T8A0A2R8Y7T8_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YG40A0A2R8YG40_HUMAN
tRNA-splicing endonuclease subunit ...
TSEN15
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG60614 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01945719G → D. Corresponds to variant dbSNP:rs2274432Ensembl.1
Natural variantiVAR_01945859Q → H. Corresponds to variant dbSNP:rs1046934Ensembl.1
Natural variantiVAR_07706176W → G in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro; may affect protein levels. 2 PublicationsCorresponds to variant dbSNP:rs730882223EnsemblClinVar.1
Natural variantiVAR_077062116H → Y in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro. 1 PublicationCorresponds to variant dbSNP:rs879253780EnsemblClinVar.1
Natural variantiVAR_077063152Y → C in PCH2F; Almost complete loss of tRNA-intron endonuclease activity in vitro; may affect protein levels. 1 PublicationCorresponds to variant dbSNP:rs879253779EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042723120 – 171REILK…ISLRR → FLLEDDIHVS in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF288394 mRNA Translation: AAG60614.1 Different initiation.
AK296655 mRNA Translation: BAG59252.1
AL157943 Genomic DNA No translation available.
AL158011 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91174.1
BC022030 mRNA Translation: AAH22030.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1361.1 [Q8WW01-1]
CCDS44286.1 [Q8WW01-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001120866.1, NM_001127394.3 [Q8WW01-2]
NP_001287693.1, NM_001300764.1
NP_001287695.1, NM_001300766.1
NP_443197.1, NM_052965.3 [Q8WW01-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000423085; ENSP00000402002; ENSG00000198860 [Q8WW01-2]
ENST00000645668; ENSP00000493902; ENSG00000198860 [Q8WW01-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116461

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:116461

UCSC genome browser

More...
UCSCi
uc001gqt.5, human [Q8WW01-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288394 mRNA Translation: AAG60614.1 Different initiation.
AK296655 mRNA Translation: BAG59252.1
AL157943 Genomic DNA No translation available.
AL158011 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91174.1
BC022030 mRNA Translation: AAH22030.1
CCDSiCCDS1361.1 [Q8WW01-1]
CCDS44286.1 [Q8WW01-2]
RefSeqiNP_001120866.1, NM_001127394.3 [Q8WW01-2]
NP_001287693.1, NM_001300764.1
NP_001287695.1, NM_001300766.1
NP_443197.1, NM_052965.3 [Q8WW01-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GW6NMR-A/B36-157[»]
BMRBiQ8WW01
SMRiQ8WW01
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi125513, 46 interactors
CORUMiQ8WW01
IntActiQ8WW01, 41 interactors
MINTiQ8WW01
STRINGi9606.ENSP00000355299

PTM databases

iPTMnetiQ8WW01
PhosphoSitePlusiQ8WW01

Polymorphism and mutation databases

BioMutaiTSEN15
DMDMi50401628

Proteomic databases

EPDiQ8WW01
jPOSTiQ8WW01
MassIVEiQ8WW01
MaxQBiQ8WW01
PaxDbiQ8WW01
PeptideAtlasiQ8WW01
PRIDEiQ8WW01
ProteomicsDBi74840 [Q8WW01-1]
74841 [Q8WW01-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34450, 102 antibodies

The DNASU plasmid repository

More...
DNASUi
116461

Genome annotation databases

EnsembliENST00000423085; ENSP00000402002; ENSG00000198860 [Q8WW01-2]
ENST00000645668; ENSP00000493902; ENSG00000198860 [Q8WW01-1]
GeneIDi116461
KEGGihsa:116461
UCSCiuc001gqt.5, human [Q8WW01-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
116461
DisGeNETi116461
EuPathDBiHostDB:ENSG00000198860.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TSEN15
HGNCiHGNC:16791, TSEN15
HPAiENSG00000198860, Low tissue specificity
MalaCardsiTSEN15
MIMi608756, gene
617026, phenotype
neXtProtiNX_Q8WW01
OpenTargetsiENSG00000198860
Orphaneti2524, Pontocerebellar hypoplasia type 2
PharmGKBiPA162407135

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S21U, Eukaryota
GeneTreeiENSGT00390000014781
HOGENOMiCLU_130469_1_0_1
InParanoidiQ8WW01
KOiK15324
OMAiRRWKEVS
OrthoDBi1522443at2759
PhylomeDBiQ8WW01
TreeFamiTF336144

Enzyme and pathway databases

BioCyciMetaCyc:HS13020-MONOMER
PathwayCommonsiQ8WW01
ReactomeiR-HSA-6784531, tRNA processing in the nucleus

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
116461, 31 hits in 844 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TSEN15, human
EvolutionaryTraceiQ8WW01

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C1orf19

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
116461
PharosiQ8WW01, Tdark

Protein Ontology

More...
PROi
PR:Q8WW01
RNActiQ8WW01, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198860, Expressed in deltoid and 215 other tissues
ExpressionAtlasiQ8WW01, baseline and differential
GenevisibleiQ8WW01, HS

Family and domain databases

Gene3Di3.40.1350.10, 1 hit
InterProiView protein in InterPro
IPR018593, tRNA-endonuc_su_Sen15
IPR011856, tRNA_endonuc-like_dom_sf
IPR036167, tRNA_intron_Endo_cat-like_sf
PfamiView protein in Pfam
PF09631, Sen15, 1 hit
SUPFAMiSSF53032, SSF53032, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEN15_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WW01
Secondary accession number(s): B4DKP0, Q9BZQ5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: March 1, 2002
Last modified: October 7, 2020
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again