Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (31 Jul 2019)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Heterogeneous nuclear ribonucleoprotein L-like

Gene

HNRNPLL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein that functions as regulator of alternative splicing for multiple target mRNAs, including PTPRC/CD45 and STAT5A. Required for alternative splicing of PTPRC.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRibonucleoprotein, RNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Heterogeneous nuclear ribonucleoprotein L-like
Short name:
hnRNPLL
Alternative name(s):
Stromal RNA-regulating factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HNRNPLL
Synonyms:HNRPLL, SRRF
ORF Names:BLOCK24
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25127 HNRNPLL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611208 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WVV9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000143889

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134987080

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HNRNPLL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
62286941

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000816091 – 542Heterogeneous nuclear ribonucleoprotein L-likeAdd BLAST542

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki26Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei35PhosphoserineCombined sources1
Modified residuei46PhosphothreonineCombined sources1
Modified residuei59PhosphoserineCombined sources1
Modified residuei68PhosphoserineCombined sources1
Modified residuei75PhosphoserineCombined sources1
Cross-linki491Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WVV9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WVV9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WVV9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WVV9

PeptideAtlas

More...
PeptideAtlasi
Q8WVV9

PRoteomics IDEntifications database

More...
PRIDEi
Q8WVV9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62989
74827 [Q8WVV9-1]
74828 [Q8WVV9-2]
74829 [Q8WVV9-3]
74830 [Q8WVV9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WVV9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WVV9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8WVV9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Detected in bone marrow stroma cells, skeletal muscle, heart, placenta, pancreas, kidney and lung.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in stimulated T-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143889 Expressed in 201 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WVV9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WVV9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046084

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HNRNPL.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124985, 100 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WVV9, 12 interactors

Molecular INTeraction database

More...
MINTi
Q8WVV9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000390625

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WVV9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini76 – 150RRM 1PROSITE-ProRule annotationAdd BLAST75
Domaini166 – 244RRM 2PROSITE-ProRule annotationAdd BLAST79
Domaini335 – 409RRM 3PROSITE-ProRule annotationAdd BLAST75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2 – 7Poly-Ser6
Compositional biasi49 – 57Poly-Gly9

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1456 Eukaryota
ENOG410XQHN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182683

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293298

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WVV9

KEGG Orthology (KO)

More...
KOi
K13159

Identification of Orthologs from Complete Genome Data

More...
OMAi
QIRIPNG

Database of Orthologous Groups

More...
OrthoDBi
1545178at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WVV9

TreeFam database of animal gene trees

More...
TreeFami
TF354318

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12781 RRM1_hnRPLL, 1 hit
cd12786 RRM2_hnRPLL, 1 hit
cd12700 RRM3_hnRPLL, 1 hit
cd12705 RRM4_hnRPLL, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006536 HnRNP-L/PTB
IPR034985 hnRPLL_RRM1
IPR034986 hnRPLL_RRM2
IPR034983 hnRPLL_RRM3
IPR034987 hnRPLL_RRM4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR021790 PTBP1_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 1 hit
PF11835 RRM_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 3 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01649 hnRNP-L_PTB, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WVV9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSSSSSPRE TYEEDREYES QAKRLKTEEG EIDYSAEEGE NRREATPRGG
60 70 80 90 100
GDGGGGGRSF SQPEAGGSHH KVSVSPVVHV RGLCESVVEA DLVEALEKFG
110 120 130 140 150
TICYVMMMPF KRQALVEFEN IDSAKECVTF AADEPVYIAG QQAFFNYSTS
160 170 180 190 200
KRITRPGNTD DPSGGNKVLL LSIQNPLYPI TVDVLYTVCN PVGKVQRIVI
210 220 230 240 250
FKRNGIQAMV EFESVLCAQK AKAALNGADI YAGCCTLKIE YARPTRLNVI
260 270 280 290 300
RNDNDSWDYT KPYLGRRDRG KGRQRQAILG EHPSSFRHDG YGSHGPLLPL
310 320 330 340 350
PSRYRMGSRD TPELVAYPLP QASSSYMHGG NPSGSVVMVS GLHQLKMNCS
360 370 380 390 400
RVFNLFCLYG NIEKVKFMKT IPGTALVEMG DEYAVERAVT HLNNVKLFGK
410 420 430 440 450
RLNVCVSKQH SVVPSQIFEL EDGTSSYKDF AMSKNNRFTS AGQASKNIIQ
460 470 480 490 500
PPSCVLHYYN VPLCVTEETF TKLCNDHEVL TFIKYKVFDA KPSAKTLSGL
510 520 530 540
LEWECKTDAV EALTALNHYQ IRVPNGSNPY TLKLCFSTSS HL
Length:542
Mass (Da):60,083
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i466FAAB47B4C59D3
GO
Isoform 2 (identifier: Q8WVV9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-282: DRGKGRQRQAILGEH → GCCWLMLKLLERSPL
     283-542: Missing.

Note: No experimental confirmation available.
Show »
Length:282
Mass (Da):31,232
Checksum:iD432953BCB303758
GO
Isoform 3 (identifier: Q8WVV9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MSSSSSSP → MLA
     268-280: DRGKGRQRQAILG → GRYFIHFRMYLIC
     281-542: Missing.

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):30,754
Checksum:i046627120FC11018
GO
Isoform 4 (identifier: Q8WVV9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MSSSSSSP → MLA

Note: No experimental confirmation available.
Show »
Length:537
Mass (Da):59,648
Checksum:i17EE18A70649654B
GO
Isoform 5 (identifier: Q8WVV9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-245: EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPT → D

Show »
Length:508
Mass (Da):56,467
Checksum:iF9E4F3C5344F4D0F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IYN3C9IYN3_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL HNRPLL, hCG_15881
537Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6W592D6W592_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL HNRPLL, hCG_15881
542Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7WPG3B7WPG3_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL
508Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BXH8H7BXH8_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JJZ7C9JJZ7_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C464H7C464_HUMAN
Heterogeneous nuclear ribonucleopro...
HNRNPLL
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0132851 – 8MSSSSSSP → MLA in isoform 3 and isoform 4. 2 Publications8
Alternative sequenceiVSP_054470211 – 245EFESV…YARPT → D in isoform 5. CuratedAdd BLAST35
Alternative sequenceiVSP_013286268 – 282DRGKG…ILGEH → GCCWLMLKLLERSPL in isoform 2. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_013288268 – 280DRGKG…QAILG → GRYFIHFRMYLIC in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_013289281 – 542Missing in isoform 3. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_013287283 – 542Missing in isoform 2. 2 PublicationsAdd BLAST260

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY236963 mRNA Translation: AAQ20084.2
AF461722
, AF461712, AF461713, AF461715, AF461717, AF461719, AF461721, AF461720, AF461718, AF461716, AF461714 Genomic DNA Translation: AAN76189.1
AF461716
, AF461712, AF461713, AF461715, AF461714 Genomic DNA Translation: AAN76190.1
AY236962 mRNA Translation: AAQ20083.1
AK291462 mRNA Translation: BAF84151.1
AC011247 Genomic DNA Translation: AAY24302.1
BC008217 mRNA Translation: AAH08217.2
BC017480 mRNA Translation: AAH17480.1
AL512692 mRNA Translation: CAH56358.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1796.2 [Q8WVV9-1]
CCDS46261.1 [Q8WVV9-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001136122.1, NM_001142650.1 [Q8WVV9-4]
NP_612403.2, NM_138394.3 [Q8WVV9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000409328; ENSP00000386575; ENSG00000143889 [Q8WVV9-5]
ENST00000409636; ENSP00000387088; ENSG00000143889 [Q8WVV9-4]
ENST00000410076; ENSP00000386695; ENSG00000143889 [Q8WVV9-3]
ENST00000449105; ENSP00000390625; ENSG00000143889 [Q8WVV9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
92906

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:92906

UCSC genome browser

More...
UCSCi
uc021vgb.2 human [Q8WVV9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236963 mRNA Translation: AAQ20084.2
AF461722
, AF461712, AF461713, AF461715, AF461717, AF461719, AF461721, AF461720, AF461718, AF461716, AF461714 Genomic DNA Translation: AAN76189.1
AF461716
, AF461712, AF461713, AF461715, AF461714 Genomic DNA Translation: AAN76190.1
AY236962 mRNA Translation: AAQ20083.1
AK291462 mRNA Translation: BAF84151.1
AC011247 Genomic DNA Translation: AAY24302.1
BC008217 mRNA Translation: AAH08217.2
BC017480 mRNA Translation: AAH17480.1
AL512692 mRNA Translation: CAH56358.1
CCDSiCCDS1796.2 [Q8WVV9-1]
CCDS46261.1 [Q8WVV9-4]
RefSeqiNP_001136122.1, NM_001142650.1 [Q8WVV9-4]
NP_612403.2, NM_138394.3 [Q8WVV9-1]

3D structure databases

SMRiQ8WVV9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124985, 100 interactors
IntActiQ8WVV9, 12 interactors
MINTiQ8WVV9
STRINGi9606.ENSP00000390625

PTM databases

iPTMnetiQ8WVV9
PhosphoSitePlusiQ8WVV9
SwissPalmiQ8WVV9

Polymorphism and mutation databases

BioMutaiHNRNPLL
DMDMi62286941

Proteomic databases

EPDiQ8WVV9
jPOSTiQ8WVV9
MaxQBiQ8WVV9
PaxDbiQ8WVV9
PeptideAtlasiQ8WVV9
PRIDEiQ8WVV9
ProteomicsDBi62989
74827 [Q8WVV9-1]
74828 [Q8WVV9-2]
74829 [Q8WVV9-3]
74830 [Q8WVV9-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409328; ENSP00000386575; ENSG00000143889 [Q8WVV9-5]
ENST00000409636; ENSP00000387088; ENSG00000143889 [Q8WVV9-4]
ENST00000410076; ENSP00000386695; ENSG00000143889 [Q8WVV9-3]
ENST00000449105; ENSP00000390625; ENSG00000143889 [Q8WVV9-1]
GeneIDi92906
KEGGihsa:92906
UCSCiuc021vgb.2 human [Q8WVV9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
92906

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HNRNPLL
HGNCiHGNC:25127 HNRNPLL
HPAiHPA046084
MIMi611208 gene
neXtProtiNX_Q8WVV9
OpenTargetsiENSG00000143889
PharmGKBiPA134987080

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1456 Eukaryota
ENOG410XQHN LUCA
GeneTreeiENSGT00950000182683
HOGENOMiHOG000293298
InParanoidiQ8WVV9
KOiK13159
OMAiQIRIPNG
OrthoDBi1545178at2759
PhylomeDBiQ8WVV9
TreeFamiTF354318

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HNRNPLL human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
92906

Protein Ontology

More...
PROi
PR:Q8WVV9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143889 Expressed in 201 organ(s), highest expression level in intestine
ExpressionAtlasiQ8WVV9 baseline and differential
GenevisibleiQ8WVV9 HS

Family and domain databases

CDDicd12781 RRM1_hnRPLL, 1 hit
cd12786 RRM2_hnRPLL, 1 hit
cd12700 RRM3_hnRPLL, 1 hit
cd12705 RRM4_hnRPLL, 1 hit
Gene3Di3.30.70.330, 4 hits
InterProiView protein in InterPro
IPR006536 HnRNP-L/PTB
IPR034985 hnRPLL_RRM1
IPR034986 hnRPLL_RRM2
IPR034983 hnRPLL_RRM3
IPR034987 hnRPLL_RRM4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR021790 PTBP1_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
PF11835 RRM_8, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01649 hnRNP-L_PTB, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHNRLL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WVV9
Secondary accession number(s): Q53T80
, Q5JB51, Q5JB52, Q659B9, Q8IVH5, Q8IVH6, Q96HR5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 1, 2002
Last modified: July 31, 2019
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again