Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C7orf43

Gene

C7orf43

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C7orf43
Gene namesi
Name:C7orf43
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000146826.14
HGNCiHGNC:25604 C7orf43
neXtProtiNX_Q8WVR3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000146826
PharmGKBiPA147358601

Polymorphism and mutation databases

BioMutaiC7orf43
DMDMi74730883

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002803441 – 580Uncharacterized protein C7orf43Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei491PhosphoserineCombined sources1
Modified residuei517PhosphoserineCombined sources1
Modified residuei541PhosphothreonineCombined sources1
Modified residuei546PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WVR3
MaxQBiQ8WVR3
PaxDbiQ8WVR3
PeptideAtlasiQ8WVR3
PRIDEiQ8WVR3
ProteomicsDBi74815
74816 [Q8WVR3-2]
74817 [Q8WVR3-3]

PTM databases

iPTMnetiQ8WVR3
PhosphoSitePlusiQ8WVR3

Expressioni

Gene expression databases

BgeeiENSG00000146826 Expressed in 209 organ(s), highest expression level in right testis
CleanExiHS_C7orf43
ExpressionAtlasiQ8WVR3 baseline and differential
GenevisibleiQ8WVR3 HS

Organism-specific databases

HPAiHPA019359
HPA029463
HPA029464

Interactioni

Protein-protein interaction databases

BioGridi120552, 17 interactors
IntActiQ8WVR3, 9 interactors
STRINGi9606.ENSP00000324741

Structurei

3D structure databases

ProteinModelPortaliQ8WVR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi54 – 134Gly-richAdd BLAST81

Phylogenomic databases

eggNOGiENOG410IH6D Eukaryota
ENOG4110E8Q LUCA
GeneTreeiENSGT00390000014725
HOGENOMiHOG000065684
HOVERGENiHBG081127
InParanoidiQ8WVR3
OMAiPVLKCRQ
OrthoDBiEOG091G04ME
PhylomeDBiQ8WVR3
TreeFamiTF331500

Family and domain databases

InterProiView protein in InterPro
IPR031626 DUF4707
PANTHERiPTHR16096 PTHR16096, 1 hit
PfamiView protein in Pfam
PF15806 DUF4707, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WVR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESQCDYSMY FPAVPLPPRA ELAGDPGRYR ALPRRNHLYL GETVRFLLVL
60 70 80 90 100
RCRGGAGSGT GGGPGLGSRG AWAELATALA ALASVSAGGG MPGGGGAGDQ
110 120 130 140 150
DSEPPGGGDP GGGGLFRGCS PLLTHGPGPA TSGGATTLPV EEPIVSTDEV
160 170 180 190 200
IFPLTVSLDR LPPGTPKAKI VVTVWKREIE APEVRDQGYL RLLQTRSPGE
210 220 230 240 250
TFRGEQSAFK AQVSTLLTLL PPPVLRCRQF TVAGKHLTVL KVLNSSSQEE
260 270 280 290 300
ISIWDIRILP NFNASYLPVM PDGSVLLVDN VCHQSGEVSM GSFCRLPGTS
310 320 330 340 350
GCFPCPLNAL EEHNFLFQLR GGEQPPPGAK EGLEVPLIAV VQWSTPKLPF
360 370 380 390 400
TQSIYTHYRL PSVRLDRPCF VMTASCKSPV RTYERFTVTY TLLNNLQDFL
410 420 430 440 450
AVRLVWTPEH AQAGKQLCEE ERRAMQAALD SVVCHTPLNN LGFSRKGSAL
460 470 480 490 500
TFSVAFQALR TGLFELSQHM KLKLQFTASV SHPPPEARPL SRKSSPSSPA
510 520 530 540 550
VRDLVERHQA SLGRSQSFSH QQPSRSHLMR SGSVMERRAI TPPVASPVGR
560 570 580
PLYLPPDKAV LSLDKIAKRE CKVLVVEPVK
Length:580
Mass (Da):62,597
Last modified:October 1, 2002 - v2
Checksum:iEF0E23FEFB98D328
GO
Isoform 2 (identifier: Q8WVR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-378: Missing.
     379-413: PVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQA → MHRLSGFENQMRLCWRRPCGNEERCSVCWSLFLPP
     466-468: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,280
Checksum:i74E4AF44E424E80A
GO
Isoform 3 (identifier: Q8WVR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-374: Missing.
     375-413: SCKSPVRTYE...LVWTPEHAQA → MHRLFTPQSG...SVCWSLFLPP

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):23,082
Checksum:i574358441EF4AD89
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KNS5B3KNS5_HUMAN
cDNA FLJ30310 fis, clone BRACE20034...
C7orf43
311Annotation score:
H7C1F8H7C1F8_HUMAN
Uncharacterized protein C7orf43
C7orf43
150Annotation score:
F8WFE0F8WFE0_HUMAN
Uncharacterized protein C7orf43
C7orf43
169Annotation score:
E9PFF9E9PFF9_HUMAN
Uncharacterized protein C7orf43
C7orf43
99Annotation score:
C9JMZ9C9JMZ9_HUMAN
Uncharacterized protein C7orf43
C7orf43
25Annotation score:

Sequence cautioni

The sequence CAB66490 differs from that shown. Reason: Frameshift at position 539.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti497S → R in CAB66490 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050817295R → H. Corresponds to variant dbSNP:rs2293477Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0236331 – 378Missing in isoform 2. 1 PublicationAdd BLAST378
Alternative sequenceiVSP_0236341 – 374Missing in isoform 3. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_023635375 – 413SCKSP…EHAQA → MHRLFTPQSGFENQMRLCWR RPCGNEERCSVCWSLFLPP in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_023636379 – 413PVRTY…EHAQA → MHRLSGFENQMRLCWRRPCG NEERCSVCWSLFLPP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_023637466 – 468Missing in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA Translation: CAB66490.1 Frameshift.
AK001787 mRNA Translation: BAA91911.1
CH236956 Genomic DNA Translation: EAL23848.1
CH471091 Genomic DNA Translation: EAW76580.1
CH471091 Genomic DNA Translation: EAW76582.1
BC002749 mRNA Translation: AAH02749.2
BC015722 mRNA Translation: AAH15722.2
CCDSiCCDS5687.1 [Q8WVR3-1]
RefSeqiNP_060745.3, NM_018275.4 [Q8WVR3-1]
UniGeneiHs.533139

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826 [Q8WVR3-1]
GeneIDi55262
KEGGihsa:55262
UCSCiuc003utr.4 human [Q8WVR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA Translation: CAB66490.1 Frameshift.
AK001787 mRNA Translation: BAA91911.1
CH236956 Genomic DNA Translation: EAL23848.1
CH471091 Genomic DNA Translation: EAW76580.1
CH471091 Genomic DNA Translation: EAW76582.1
BC002749 mRNA Translation: AAH02749.2
BC015722 mRNA Translation: AAH15722.2
CCDSiCCDS5687.1 [Q8WVR3-1]
RefSeqiNP_060745.3, NM_018275.4 [Q8WVR3-1]
UniGeneiHs.533139

3D structure databases

ProteinModelPortaliQ8WVR3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120552, 17 interactors
IntActiQ8WVR3, 9 interactors
STRINGi9606.ENSP00000324741

PTM databases

iPTMnetiQ8WVR3
PhosphoSitePlusiQ8WVR3

Polymorphism and mutation databases

BioMutaiC7orf43
DMDMi74730883

Proteomic databases

EPDiQ8WVR3
MaxQBiQ8WVR3
PaxDbiQ8WVR3
PeptideAtlasiQ8WVR3
PRIDEiQ8WVR3
ProteomicsDBi74815
74816 [Q8WVR3-2]
74817 [Q8WVR3-3]

Protocols and materials databases

DNASUi55262
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826 [Q8WVR3-1]
GeneIDi55262
KEGGihsa:55262
UCSCiuc003utr.4 human [Q8WVR3-1]

Organism-specific databases

CTDi55262
EuPathDBiHostDB:ENSG00000146826.14
GeneCardsiC7orf43
H-InvDBiHIX0006912
HGNCiHGNC:25604 C7orf43
HPAiHPA019359
HPA029463
HPA029464
neXtProtiNX_Q8WVR3
OpenTargetsiENSG00000146826
PharmGKBiPA147358601
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IH6D Eukaryota
ENOG4110E8Q LUCA
GeneTreeiENSGT00390000014725
HOGENOMiHOG000065684
HOVERGENiHBG081127
InParanoidiQ8WVR3
OMAiPVLKCRQ
OrthoDBiEOG091G04ME
PhylomeDBiQ8WVR3
TreeFamiTF331500

Miscellaneous databases

GeneWikiiC7orf43
GenomeRNAii55262
PROiPR:Q8WVR3

Gene expression databases

BgeeiENSG00000146826 Expressed in 209 organ(s), highest expression level in right testis
CleanExiHS_C7orf43
ExpressionAtlasiQ8WVR3 baseline and differential
GenevisibleiQ8WVR3 HS

Family and domain databases

InterProiView protein in InterPro
IPR031626 DUF4707
PANTHERiPTHR16096 PTHR16096, 1 hit
PfamiView protein in Pfam
PF15806 DUF4707, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCG043_HUMAN
AccessioniPrimary (citable) accession number: Q8WVR3
Secondary accession number(s): A4D2A9
, D6W5U4, Q9BQJ1, Q9BUB6, Q9NV47
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: October 1, 2002
Last modified: November 7, 2018
This is version 113 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again