Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (13 Nov 2019)
Sequence version 2 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Microtubule-associated protein 11

Gene

MAP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule associated protein wich seems to play a role in spindle dynamics and cell division (PubMed:30715179, PubMed:30447097). Modulates YAP1 activity as transcriptional regulator (PubMed:30447097).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • alpha-tubulin binding Source: UniProtKB

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein 11Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAP11Imported
Synonyms:C7orf43Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25604 MAP11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618350 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WVR3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Microcephaly 25, primary, autosomal recessive (MCPH25)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of microcephaly, a disease defined as a head circumference more than 3 standard deviations below the age, sex and ethnically matched mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. MCPH25 patients additionally manifest global developmental delay, severe intellectual disability with speech impairment, attention deficit-hyperactivity disorder, and reduced white matter and thin corpus callosum on brain imaging.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081463205 – 580Missing in MCPH25. 1 PublicationAdd BLAST376

Keywords - Diseasei

Disease mutation, Primary microcephaly

Organism-specific databases

MalaCards human disease database

More...
MalaCardsi
MAP11
MIMi618351 phenotype

NIAGADS Genomics Database

More...
NIAGADSi
ENSG00000146826

Open Targets

More...
OpenTargetsi
ENSG00000146826

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2512 Autosomal recessive primary microcephaly

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA147358601

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WVR3

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C7orf43

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730883

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002803441 – 580Microtubule-associated protein 11Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei491PhosphoserineCombined sources1
Modified residuei517PhosphoserineCombined sources1
Modified residuei541PhosphothreonineCombined sources1
Modified residuei546PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WVR3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WVR3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WVR3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WVR3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WVR3

PeptideAtlas

More...
PeptideAtlasi
Q8WVR3

PRoteomics IDEntifications database

More...
PRIDEi
Q8WVR3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
74815 [Q8WVR3-1]
74816 [Q8WVR3-2]
74817 [Q8WVR3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WVR3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WVR3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed. High levels in brain, cerebellum, testis and whole blood.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146826 Expressed in 209 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WVR3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WVR3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019359
HPA029463
HPA029464

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with alpha-tubulin during mitosis.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120552, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WVR3, 20 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000324741

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi54 – 134Gly-richAdd BLAST81

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IH6D Eukaryota
ENOG4110E8Q LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014725

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000065684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WVR3

Identification of Orthologs from Complete Genome Data

More...
OMAi
TASCKSP

Database of Orthologous Groups

More...
OrthoDBi
536210at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WVR3

TreeFam database of animal gene trees

More...
TreeFami
TF331500

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031626 MAP11

The PANTHER Classification System

More...
PANTHERi
PTHR16096 PTHR16096, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15806 DUF4707, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WVR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESQCDYSMY FPAVPLPPRA ELAGDPGRYR ALPRRNHLYL GETVRFLLVL
60 70 80 90 100
RCRGGAGSGT GGGPGLGSRG AWAELATALA ALASVSAGGG MPGGGGAGDQ
110 120 130 140 150
DSEPPGGGDP GGGGLFRGCS PLLTHGPGPA TSGGATTLPV EEPIVSTDEV
160 170 180 190 200
IFPLTVSLDR LPPGTPKAKI VVTVWKREIE APEVRDQGYL RLLQTRSPGE
210 220 230 240 250
TFRGEQSAFK AQVSTLLTLL PPPVLRCRQF TVAGKHLTVL KVLNSSSQEE
260 270 280 290 300
ISIWDIRILP NFNASYLPVM PDGSVLLVDN VCHQSGEVSM GSFCRLPGTS
310 320 330 340 350
GCFPCPLNAL EEHNFLFQLR GGEQPPPGAK EGLEVPLIAV VQWSTPKLPF
360 370 380 390 400
TQSIYTHYRL PSVRLDRPCF VMTASCKSPV RTYERFTVTY TLLNNLQDFL
410 420 430 440 450
AVRLVWTPEH AQAGKQLCEE ERRAMQAALD SVVCHTPLNN LGFSRKGSAL
460 470 480 490 500
TFSVAFQALR TGLFELSQHM KLKLQFTASV SHPPPEARPL SRKSSPSSPA
510 520 530 540 550
VRDLVERHQA SLGRSQSFSH QQPSRSHLMR SGSVMERRAI TPPVASPVGR
560 570 580
PLYLPPDKAV LSLDKIAKRE CKVLVVEPVK
Length:580
Mass (Da):62,597
Last modified:October 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEF0E23FEFB98D328
GO
Isoform 2 (identifier: Q8WVR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-378: Missing.
     379-413: PVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQA → MHRLSGFENQMRLCWRRPCGNEERCSVCWSLFLPP
     466-468: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,280
Checksum:i74E4AF44E424E80A
GO
Isoform 3 (identifier: Q8WVR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-374: Missing.
     375-413: SCKSPVRTYE...LVWTPEHAQA → MHRLFTPQSG...SVCWSLFLPP

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):23,082
Checksum:i574358441EF4AD89
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KNS5B3KNS5_HUMAN
Microtubule-associated protein 11
MAP11
311Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WFE0F8WFE0_HUMAN
Microtubule-associated protein 11
MAP11
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1F8H7C1F8_HUMAN
Microtubule-associated protein 11
MAP11
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PFF9E9PFF9_HUMAN
Microtubule-associated protein 11
MAP11
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JMZ9C9JMZ9_HUMAN
Microtubule-associated protein 11
MAP11
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB66490 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti497S → R in CAB66490 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_081463205 – 580Missing in MCPH25. 1 PublicationAdd BLAST376
Natural variantiVAR_050817295R → H. Corresponds to variant dbSNP:rs2293477Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0236331 – 378Missing in isoform 2. 1 PublicationAdd BLAST378
Alternative sequenceiVSP_0236341 – 374Missing in isoform 3. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_023635375 – 413SCKSP…EHAQA → MHRLFTPQSGFENQMRLCWR RPCGNEERCSVCWSLFLPP in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_023636379 – 413PVRTY…EHAQA → MHRLSGFENQMRLCWRRPCG NEERCSVCWSLFLPP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_023637466 – 468Missing in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136555 mRNA Translation: CAB66490.1 Frameshift.
AK001787 mRNA Translation: BAA91911.1
CH236956 Genomic DNA Translation: EAL23848.1
CH471091 Genomic DNA Translation: EAW76580.1
CH471091 Genomic DNA Translation: EAW76582.1
BC002749 mRNA Translation: AAH02749.2
BC015722 mRNA Translation: AAH15722.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5687.1 [Q8WVR3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_060745.3, NM_018275.4 [Q8WVR3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000316937; ENSP00000324741; ENSG00000146826 [Q8WVR3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55262

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55262

UCSC genome browser

More...
UCSCi
uc003utr.4 human [Q8WVR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA Translation: CAB66490.1 Frameshift.
AK001787 mRNA Translation: BAA91911.1
CH236956 Genomic DNA Translation: EAL23848.1
CH471091 Genomic DNA Translation: EAW76580.1
CH471091 Genomic DNA Translation: EAW76582.1
BC002749 mRNA Translation: AAH02749.2
BC015722 mRNA Translation: AAH15722.2
CCDSiCCDS5687.1 [Q8WVR3-1]
RefSeqiNP_060745.3, NM_018275.4 [Q8WVR3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120552, 18 interactors
IntActiQ8WVR3, 20 interactors
STRINGi9606.ENSP00000324741

PTM databases

iPTMnetiQ8WVR3
PhosphoSitePlusiQ8WVR3

Polymorphism and mutation databases

BioMutaiC7orf43
DMDMi74730883

Proteomic databases

EPDiQ8WVR3
jPOSTiQ8WVR3
MassIVEiQ8WVR3
MaxQBiQ8WVR3
PaxDbiQ8WVR3
PeptideAtlasiQ8WVR3
PRIDEiQ8WVR3
ProteomicsDBi74815 [Q8WVR3-1]
74816 [Q8WVR3-2]
74817 [Q8WVR3-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55262

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826 [Q8WVR3-1]
GeneIDi55262
KEGGihsa:55262
UCSCiuc003utr.4 human [Q8WVR3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55262

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAP11
HGNCiHGNC:25604 MAP11
HPAiHPA019359
HPA029463
HPA029464
MalaCardsiMAP11
MIMi618350 gene
618351 phenotype
neXtProtiNX_Q8WVR3
NIAGADSiENSG00000146826
OpenTargetsiENSG00000146826
Orphaneti2512 Autosomal recessive primary microcephaly
PharmGKBiPA147358601

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IH6D Eukaryota
ENOG4110E8Q LUCA
GeneTreeiENSGT00390000014725
HOGENOMiHOG000065684
InParanoidiQ8WVR3
OMAiTASCKSP
OrthoDBi536210at2759
PhylomeDBiQ8WVR3
TreeFamiTF331500

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C7orf43 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C7orf43

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55262
PharosiQ8WVR3

Protein Ontology

More...
PROi
PR:Q8WVR3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146826 Expressed in 209 organ(s), highest expression level in right testis
ExpressionAtlasiQ8WVR3 baseline and differential
GenevisibleiQ8WVR3 HS

Family and domain databases

InterProiView protein in InterPro
IPR031626 MAP11
PANTHERiPTHR16096 PTHR16096, 1 hit
PfamiView protein in Pfam
PF15806 DUF4707, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMA11_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WVR3
Secondary accession number(s): A4D2A9
, D6W5U4, Q9BQJ1, Q9BUB6, Q9NV47
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: October 1, 2002
Last modified: November 13, 2019
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again