Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BRICK1

Gene

BRK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).By similarity1 Publication

GO - Molecular functioni

  • protein-containing complex binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SIGNORiQ8WUW1

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BRICK1
Short name:
BRK1
Gene namesi
Name:BRK1
Synonyms:C3orf10
ORF Names:HSPC300, MDS027
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000254999.3
HGNCiHGNC:23057 BRK1
MIMi611183 gene
neXtProtiNX_Q8WUW1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi55845
OpenTargetsiENSG00000254999
PharmGKBiPA134866423

Chemistry databases

ChEMBLiCHEMBL3758062

Polymorphism and mutation databases

BioMutaiBRK1
DMDMi74730773

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002836462 – 75Protein BRICK1Add BLAST74

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8WUW1
MaxQBiQ8WUW1
PaxDbiQ8WUW1
PeptideAtlasiQ8WUW1
PRIDEiQ8WUW1
ProteomicsDBi74714
74715 [Q8WUW1-2]
TopDownProteomicsiQ8WUW1-1 [Q8WUW1-1]
Q8WUW1-2 [Q8WUW1-2]

PTM databases

iPTMnetiQ8WUW1
PhosphoSitePlusiQ8WUW1

Expressioni

Gene expression databases

BgeeiENSG00000254999 Expressed in 197 organ(s), highest expression level in sperm
CleanExiHS_C3orf10
GenevisibleiQ8WUW1 HS

Organism-specific databases

HPAiHPA060391

Interactioni

Subunit structurei

Homotrimer when in free form. Directly interacts with WASF2. Component of the WAVE1 complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterodimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi120947, 25 interactors
CORUMiQ8WUW1
DIPiDIP-41554N
IntActiQ8WUW1, 33 interactors
MINTiQ8WUW1
STRINGi9606.ENSP00000432472

Structurei

Secondary structure

175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8WUW1
SMRiQ8WUW1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WUW1

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili41 – 72Sequence analysisAdd BLAST32

Sequence similaritiesi

Belongs to the BRK1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J0X8 Eukaryota
ENOG4111UHX LUCA
GeneTreeiENSGT00390000011082
HOVERGENiHBG107432
InParanoidiQ8WUW1
KOiK05752
OMAiEACVTQG
OrthoDBiEOG091G172W
PhylomeDBiQ8WUW1
TreeFamiTF324876

Family and domain databases

InterProiView protein in InterPro
IPR033378 BRICK1
PANTHERiPTHR33668 PTHR33668, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD593487 PD593487, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8WUW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGQEDPVQR EIHQDWANRE YIEIITSSIK KIADFLNSFD MSCRSRLATL
60 70
NEKLTALERR IEYIEARVTK GETLT
Length:75
Mass (Da):8,745
Last modified:March 1, 2002 - v1
Checksum:i637B5461A2D96587
GO
Isoform 2 (identifier: Q8WUW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     75-75: T → TRTVPCCCWEVALHNTGHMGKAPAAFSSFLSP

Note: No experimental confirmation available.
Show »
Length:106
Mass (Da):12,046
Checksum:i908E7A141251DFE5
GO

Sequence cautioni

The sequence AAF28978 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02435075T → TRTVPCCCWEVALHNTGHMG KAPAAFSSFLSP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY148219 mRNA Translation: AAN60161.1
AY148220 mRNA Translation: AAN60162.1
AF161418 mRNA Translation: AAF28978.1 Different initiation.
AK312155 mRNA Translation: BAG35089.1
CH471055 Genomic DNA Translation: EAW64061.1
BC001067 mRNA Translation: AAH01067.1
BC007929 mRNA Translation: AAH07929.1
BC019303 mRNA Translation: AAH19303.1
CCDSiCCDS54553.1 [Q8WUW1-1]
RefSeqiNP_060932.2, NM_018462.4 [Q8WUW1-1]
UniGeneiHs.649307

Genome annotation databases

EnsembliENST00000530758; ENSP00000432472; ENSG00000254999 [Q8WUW1-1]
GeneIDi55845
KEGGihsa:55845
UCSCiuc003bvb.4 human [Q8WUW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY148219 mRNA Translation: AAN60161.1
AY148220 mRNA Translation: AAN60162.1
AF161418 mRNA Translation: AAF28978.1 Different initiation.
AK312155 mRNA Translation: BAG35089.1
CH471055 Genomic DNA Translation: EAW64061.1
BC001067 mRNA Translation: AAH01067.1
BC007929 mRNA Translation: AAH07929.1
BC019303 mRNA Translation: AAH19303.1
CCDSiCCDS54553.1 [Q8WUW1-1]
RefSeqiNP_060932.2, NM_018462.4 [Q8WUW1-1]
UniGeneiHs.649307

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3P8CX-ray2.29E1-75[»]
4N78X-ray2.43E1-75[»]
ProteinModelPortaliQ8WUW1
SMRiQ8WUW1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120947, 25 interactors
CORUMiQ8WUW1
DIPiDIP-41554N
IntActiQ8WUW1, 33 interactors
MINTiQ8WUW1
STRINGi9606.ENSP00000432472

Chemistry databases

ChEMBLiCHEMBL3758062

PTM databases

iPTMnetiQ8WUW1
PhosphoSitePlusiQ8WUW1

Polymorphism and mutation databases

BioMutaiBRK1
DMDMi74730773

Proteomic databases

EPDiQ8WUW1
MaxQBiQ8WUW1
PaxDbiQ8WUW1
PeptideAtlasiQ8WUW1
PRIDEiQ8WUW1
ProteomicsDBi74714
74715 [Q8WUW1-2]
TopDownProteomicsiQ8WUW1-1 [Q8WUW1-1]
Q8WUW1-2 [Q8WUW1-2]

Protocols and materials databases

DNASUi55845
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000530758; ENSP00000432472; ENSG00000254999 [Q8WUW1-1]
GeneIDi55845
KEGGihsa:55845
UCSCiuc003bvb.4 human [Q8WUW1-1]

Organism-specific databases

CTDi55845
DisGeNETi55845
EuPathDBiHostDB:ENSG00000254999.3
GeneCardsiBRK1
HGNCiHGNC:23057 BRK1
HPAiHPA060391
MIMi611183 gene
neXtProtiNX_Q8WUW1
OpenTargetsiENSG00000254999
PharmGKBiPA134866423
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0X8 Eukaryota
ENOG4111UHX LUCA
GeneTreeiENSGT00390000011082
HOVERGENiHBG107432
InParanoidiQ8WUW1
KOiK05752
OMAiEACVTQG
OrthoDBiEOG091G172W
PhylomeDBiQ8WUW1
TreeFamiTF324876

Enzyme and pathway databases

ReactomeiR-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-5663213 RHO GTPases Activate WASPs and WAVEs
SIGNORiQ8WUW1

Miscellaneous databases

ChiTaRSiBRK1 human
EvolutionaryTraceiQ8WUW1
GeneWikiiC3orf10
GenomeRNAii55845
PROiPR:Q8WUW1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000254999 Expressed in 197 organ(s), highest expression level in sperm
CleanExiHS_C3orf10
GenevisibleiQ8WUW1 HS

Family and domain databases

InterProiView protein in InterPro
IPR033378 BRICK1
PANTHERiPTHR33668 PTHR33668, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD593487 PD593487, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBRK1_HUMAN
AccessioniPrimary (citable) accession number: Q8WUW1
Secondary accession number(s): B2R5E2, Q9P082
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2002
Last modified: November 7, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again