Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (13 Feb 2019)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transmembrane protein 174

Gene

TMEM174

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 174
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM174
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164325.7

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28187 TMEM174

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614909 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WUU8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei40 – 60HelicalSequence analysisAdd BLAST21
Transmembranei73 – 93HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000164325

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162405935

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMEM174

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74730764

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002825771 – 243Transmembrane protein 174Add BLAST243

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WUU8

PeptideAtlas

More...
PeptideAtlasi
Q8WUU8

PRoteomics IDEntifications database

More...
PRIDEi
Q8WUU8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74712
74713 [Q8WUU8-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WUU8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164325 Expressed in 108 organ(s), highest expression level in kidney epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WUU8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WUU8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037975

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SGTAO437655EBI-10276729,EBI-347996

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126393, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WUU8, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000296776

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8WUU8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IR9J Eukaryota
ENOG410YMC9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004161

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059655

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG095684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WUU8

Identification of Orthologs from Complete Genome Data

More...
OMAi
MLSCQLC

Database of Orthologous Groups

More...
OrthoDBi
1122990at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WUU8

TreeFam database of animal gene trees

More...
TreeFami
TF335512

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027835 TMEM174

The PANTHER Classification System

More...
PANTHERi
PTHR31020 PTHR31020, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15029 TMEM174, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8WUU8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQGSGRLED FPVNVFSVTP YTPSTADIQV SDDDKAGATL LFSGIFLGLV
60 70 80 90 100
GITFTVMGWI KYQGVSHFEW TQLLGPVLLS VGVTFILIAV CKFKMLSCQL
110 120 130 140 150
CKESEERVPD SEQTPGGPSF VFTGINQPIT FHGATVVQYI PPPYGSPEPM
160 170 180 190 200
GINTSYLQSV VSPCGLITSG GAAAAMSSPP QYYTIYPQDN SAFVVDEGCL
210 220 230 240
SFTDGGNHRP NPDVDQLEET QLEEEACACF SPPPYEEIYS LPR
Length:243
Mass (Da):26,287
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05A764F265B50258
GO
Isoform 2 (identifier: Q8WUU8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-243: PNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR → YGPILMLTS

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,371
Checksum:iA20FA1C66AE9003B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024210210 – 243PNPDV…YSLPR → YGPILMLTS in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK055830 mRNA Translation: BAB71025.1
AK315460 mRNA Translation: BAG37847.1
CH471084 Genomic DNA Translation: EAW95719.1
BC019346 mRNA Translation: AAH19346.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4018.1 [Q8WUU8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_694949.1, NM_153217.2 [Q8WUU8-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.508588

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296776; ENSP00000296776; ENSG00000164325 [Q8WUU8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
134288

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:134288

UCSC genome browser

More...
UCSCi
uc010izc.4 human [Q8WUU8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055830 mRNA Translation: BAB71025.1
AK315460 mRNA Translation: BAG37847.1
CH471084 Genomic DNA Translation: EAW95719.1
BC019346 mRNA Translation: AAH19346.1
CCDSiCCDS4018.1 [Q8WUU8-1]
RefSeqiNP_694949.1, NM_153217.2 [Q8WUU8-1]
UniGeneiHs.508588

3D structure databases

ProteinModelPortaliQ8WUU8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126393, 2 interactors
IntActiQ8WUU8, 10 interactors
STRINGi9606.ENSP00000296776

PTM databases

PhosphoSitePlusiQ8WUU8

Polymorphism and mutation databases

BioMutaiTMEM174
DMDMi74730764

Proteomic databases

PaxDbiQ8WUU8
PeptideAtlasiQ8WUU8
PRIDEiQ8WUU8
ProteomicsDBi74712
74713 [Q8WUU8-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
134288
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296776; ENSP00000296776; ENSG00000164325 [Q8WUU8-1]
GeneIDi134288
KEGGihsa:134288
UCSCiuc010izc.4 human [Q8WUU8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
134288
EuPathDBiHostDB:ENSG00000164325.7

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM174
HGNCiHGNC:28187 TMEM174
HPAiHPA037975
MIMi614909 gene
neXtProtiNX_Q8WUU8
OpenTargetsiENSG00000164325
PharmGKBiPA162405935

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IR9J Eukaryota
ENOG410YMC9 LUCA
GeneTreeiENSGT00390000004161
HOGENOMiHOG000059655
HOVERGENiHBG095684
InParanoidiQ8WUU8
OMAiMLSCQLC
OrthoDBi1122990at2759
PhylomeDBiQ8WUU8
TreeFamiTF335512

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
134288

Protein Ontology

More...
PROi
PR:Q8WUU8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164325 Expressed in 108 organ(s), highest expression level in kidney epithelium
ExpressionAtlasiQ8WUU8 baseline and differential
GenevisibleiQ8WUU8 HS

Family and domain databases

InterProiView protein in InterPro
IPR027835 TMEM174
PANTHERiPTHR31020 PTHR31020, 1 hit
PfamiView protein in Pfam
PF15029 TMEM174, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM174_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WUU8
Secondary accession number(s): B2RDA0, Q96N81
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2002
Last modified: February 13, 2019
This is version 104 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again