Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone deacetylase 7

Gene

HDAC7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors (By similarity). May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Positively regulates the transcriptional repressor activity of FOXP3 (PubMed:17360565).By similarity2 Publications

Miscellaneous

Its activity is inhibited by Trichostatin A (TSA), a known histone deacetylase inhibitor.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone. EC:3.5.1.98

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi533Zinc1
Metal bindingi535Zinc1
Metal bindingi541Zinc1
Metal bindingi618Zinc1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei670By similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei843Contributes to catalysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Hydrolase, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.5.1.98 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants
R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-8943724 Regulation of PTEN gene transcription

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8WUI4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Histone deacetylase 7 (EC:3.5.1.98)
Short name:
HD7
Alternative name(s):
Histone deacetylase 7A
Short name:
HD7a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HDAC7
Synonyms:HDAC7A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000061273.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14067 HDAC7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606542 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WUI4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi150L → A: Abolishes phosphorylation at S-155. 1 Publication1
Mutagenesisi155S → A: Abolishes nuclear export; when associated with A-181; A-358 and A-486. Abolishes phosphorylation by MARK2 and MARK3, interaction with 14-3-3 and localization to the cytoplasm. 1 Publication1
Mutagenesisi181S → A: Abolishes nuclear export; when associated with A-155; A-358 and A-486. 1 Publication1
Mutagenesisi358S → A: Abolishes nuclear export; when associated with A-192; A-1118 and A-486. 1 Publication1
Mutagenesisi486S → A: Abolishes nuclear export; when associated with A-192; A-1118 and A-358. 1 Publication1
Mutagenesisi843H → A: Enhanced deacetylase activity. 1 Publication1
Mutagenesisi843H → F: Enhanced deacetylase activity. 1 Publication1
Mutagenesisi843H → Y: 6000 fold increase in deacetylase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51564

Open Targets

More...
OpenTargetsi
ENSG00000061273

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162390579

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2716

Drug and drug target database

More...
DrugBanki
DB05015 Belinostat
DB06603 Panobinostat

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2661

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HDAC7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
30913097

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001147051 – 952Histone deacetylase 7Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei109PhosphoserineCombined sources1
Modified residuei155Phosphoserine; by MARK2, MARK3 and PKD/PRKD11 Publication1
Modified residuei181Phosphoserine; by PKD/PRKD2Combined sources2 Publications1
Modified residuei283PhosphoserineCombined sources1
Modified residuei286PhosphothreonineCombined sources1
Modified residuei358Phosphoserine; by PKD/PRKD1By similarity1
Modified residuei364PhosphoserineCombined sources1
Modified residuei405PhosphoserineCombined sources1
Modified residuei486PhosphoserineCombined sources1
Modified residuei487PhosphoserineCombined sources1
Modified residuei507PhosphoserineCombined sources1
Modified residuei595PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

May be phosphorylated by CaMK1. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import. Phosphorylation at Ser-155 by MARK2, MARK3 and PRKD1 promotes interaction with 14-3-3 proteins and export from the nucleus. Phosphorylation at Ser-155 is a prerequisite for phosphorylation at Ser-181.3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WUI4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WUI4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WUI4

PeptideAtlas

More...
PeptideAtlasi
Q8WUI4

PRoteomics IDEntifications database

More...
PRIDEi
Q8WUI4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
74678
74679 [Q8WUI4-10]
74680 [Q8WUI4-2]
74681 [Q8WUI4-3]
74682 [Q8WUI4-4]
74683 [Q8WUI4-5]
74684 [Q8WUI4-6]
74685 [Q8WUI4-7]
74686 [Q8WUI4-8]
74687 [Q8WUI4-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WUI4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WUI4

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q8WUI4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000061273 Expressed in 224 organ(s), highest expression level in left adrenal gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_HDAC7

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WUI4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WUI4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA004775

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HDAC1, HDAC2, HDAC3, HDAC4, HDAC5, NCOR1, NCOR2, SIN3A, SIN3B, RBBP4, RBBP7, MTA1L1, SAP30 and MBD3. Interacts with the 14-3-3 protein YWHAE, MEF2A, MEF2B and MEF2C (By similarity). Interacts with KAT5 and EDNRA. Interacts with KDM5B. Interacts with ZMYND15 (By similarity). Interacts with PML (isoform PML-4). Interacts with FOXP3.By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119613, 95 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8WUI4

Database of interacting proteins

More...
DIPi
DIP-29860N

Protein interaction database and analysis system

More...
IntActi
Q8WUI4, 49 interactors

Molecular INTeraction database

More...
MINTi
Q8WUI4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000080059

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8WUI4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1952
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8WUI4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WUI4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8WUI4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 268Transcription repression 1By similarityAdd BLAST268
Regioni1 – 98Interaction with MEF2CBy similarityAdd BLAST98
Regioni49 – 149Interaction with MEF2ABy similarityAdd BLAST101
Regioni218 – 546Transcription repression 2By similarityAdd BLAST329
Regioni518 – 865Histone deacetylaseAdd BLAST348
Regioni877 – 952Interaction with SIN3ABy similarityAdd BLAST76

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi918 – 952Nuclear export signalBy similarityAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi197 – 203Poly-Ser7
Compositional biasi368 – 373Poly-Pro6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The nuclear export sequence mediates the shuttling between the nucleus and the cytoplasm.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1343 Eukaryota
COG0123 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159065

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057100

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WUI4

KEGG Orthology (KO)

More...
KOi
K11408

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8WUI4

TreeFam database of animal gene trees

More...
TreeFami
TF106174

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.800.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000286 His_deacetylse
IPR023801 His_deacetylse_dom
IPR037138 His_deacetylse_dom_sf
IPR017320 Histone_deAcase_II_euk
IPR023696 Ureohydrolase_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10625 PTHR10625, 4 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00850 Hist_deacetyl, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037911 HDAC_II_euk, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01270 HDASUPER

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52768 SSF52768, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 18 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WUI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLRVGQRPP VEPPPEPTLL ALQRPQRLHH HLFLAGLQQQ RSVEPMRLSM
60 70 80 90 100
DTPMPELQVG PQEQELRQLL HKDKSKRSAV ASSVVKQKLA EVILKKQQAA
110 120 130 140 150
LERTVHPNSP GIPYRTLEPL ETEGATRSML SSFLPPVPSL PSDPPEHFPL
160 170 180 190 200
RKTVSEPNLK LRYKPKKSLE RRKNPLLRKE SAPPSLRRRP AETLGDSSPS
210 220 230 240 250
SSSTPASGCS SPNDSEHGPN PILGSEALLG QRLRLQETSV APFALPTVSL
260 270 280 290 300
LPAITLGLPA PARADSDRRT HPTLGPRGPI LGSPHTPLFL PHGLEPEAGG
310 320 330 340 350
TLPSRLQPIL LLDPSGSHAP LLTVPGLGPL PFHFAQSLMT TERLSGSGLH
360 370 380 390 400
WPLSRTRSEP LPPSATAPPP PGPMQPRLEQ LKTHVQVIKR SAKPSEKPRL
410 420 430 440 450
RQIPSAEDLE TDGGGPGQVV DDGLEHRELG HGQPEARGPA PLQQHPQVLL
460 470 480 490 500
WEQQRLAGRL PRGSTGDTVL LPLAQGGHRP LSRAQSSPAA PASLSAPEPA
510 520 530 540 550
SQARVLSSSE TPARTLPFTT GLIYDSVMLK HQCSCGDNSR HPEHAGRIQS
560 570 580 590 600
IWSRLQERGL RSQCECLRGR KASLEELQSV HSERHVLLYG TNPLSRLKLD
610 620 630 640 650
NGKLAGLLAQ RMFVMLPCGG VGVDTDTIWN ELHSSNAARW AAGSVTDLAF
660 670 680 690 700
KVASRELKNG FAVVRPPGHH ADHSTAMGFC FFNSVAIACR QLQQQSKASK
710 720 730 740 750
ILIVDWDVHH GNGTQQTFYQ DPSVLYISLH RHDDGNFFPG SGAVDEVGAG
760 770 780 790 800
SGEGFNVNVA WAGGLDPPMG DPEYLAAFRI VVMPIAREFS PDLVLVSAGF
810 820 830 840 850
DAAEGHPAPL GGYHVSAKCF GYMTQQLMNL AGGAVVLALE GGHDLTAICD
860 870 880 890 900
ASEACVAALL GNRVDPLSEE GWKQKPNLNA IRSLEAVIRV HSKYWGCMQR
910 920 930 940 950
LASCPDSWVP RVPGADKEEV EAVTALASLS VGILAEDRPS EQLVEEEEPM

NL
Length:952
Mass (Da):102,927
Last modified:May 16, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i786785B084667731
GO
Isoform 2 (identifier: Q8WUI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-472: Missing.
     473-520: LAQGGHRPLS...TPARTLPFTT → MQACVGVRGV...WVPALTLAPA

Note: No experimental confirmation available.
Show »
Length:480
Mass (Da):51,829
Checksum:i0276ABAAAB3DC052
GO
Isoform 3 (identifier: Q8WUI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-263: Missing.

Show »
Length:915
Mass (Da):99,093
Checksum:iE828F548BB42ABDC
GO
Isoform 4 (identifier: Q8WUI4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-256: Missing.

Note: No experimental confirmation available.
Show »
Length:922
Mass (Da):99,755
Checksum:i398316C4225621DA
GO
Isoform 5 (identifier: Q8WUI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM

Show »
Length:991
Mass (Da):106,740
Checksum:i3493E377594FFC18
GO
Isoform 6 (identifier: Q8WUI4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHSPGAGCPRPCADTPGPQPQPM

Show »
Length:974
Mass (Da):105,111
Checksum:i86EA1E69F1CEF667
GO
Isoform 7 (identifier: Q8WUI4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM
     227-263: Missing.

Show »
Length:954
Mass (Da):102,906
Checksum:iA5DDAB73E16AD10D
GO
Isoform 8 (identifier: Q8WUI4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSDLRKRELGALFTSRGTGGVEWDGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM
     892-952: SKYWGCMQRL...LVEEEEPMNL → MGALTLSQIP...QGLTKKKWRQ

Show »
Length:1,014
Mass (Da):108,937
Checksum:i77630923616F2890
GO
Isoform 9 (identifier: Q8WUI4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-527: Missing.

Show »
Length:425
Mass (Da):46,041
Checksum:iF9EACA7D416CD74E
GO
Isoform 10 (identifier: Q8WUI4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-338: Missing.

Show »
Length:614
Mass (Da):66,187
Checksum:i2B638DD8C866B502
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KPH8J3KPH8_HUMAN
Histone deacetylase
HDAC7
1,014Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JEB6C9JEB6_HUMAN
Histone deacetylase 7
HDAC7
274Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNI4C9JNI4_HUMAN
Histone deacetylase 7
HDAC7
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH91H0YH91_HUMAN
Histone deacetylase 7
HDAC7
384Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHJ5H0YHJ5_HUMAN
Histone deacetylase 7
HDAC7
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYQ4A0A087WYQ4_HUMAN
Histone deacetylase 7
HDAC7
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JVZ1C9JVZ1_HUMAN
Histone deacetylase 7
HDAC7
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI41H0YI41_HUMAN
Histone deacetylase 7
HDAC7
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWY3F8VWY3_HUMAN
Histone deacetylase 7
HDAC7
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J102C9J102_HUMAN
Histone deacetylase 7
HDAC7
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF63491 differs from that shown. Reason: Frameshift at position 877.Curated
The sequence BAA91474 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91545 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15759 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55363 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC56929 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50M → T in BAG64517 (PubMed:14702039).Curated1
Sequence conflicti225 – 264Missing in AAF63491 (Ref. 1) CuratedAdd BLAST40
Sequence conflicti276P → L in BAA91545 (PubMed:14702039).Curated1
Sequence conflicti561R → L in BAA91545 (PubMed:14702039).Curated1
Sequence conflicti614V → E in AAF63491 (Ref. 1) Curated1
Sequence conflicti644S → R in BAB15759 (PubMed:14702039).Curated1
Sequence conflicti665R → W in BAA91474 (PubMed:14702039).Curated1
Sequence conflicti700K → KASK in AAF63491 (Ref. 1) Curated1
Sequence conflicti750G → S in BAA91545 (PubMed:14702039).Curated1
Sequence conflicti777A → T in BAB55363 (PubMed:14702039).Curated1
Sequence conflicti825Q → H in BAA91474 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03604343V → M in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0381021 – 527Missing in isoform 9. 1 PublicationAdd BLAST527
Alternative sequenceiVSP_0074291 – 472Missing in isoform 2. 1 PublicationAdd BLAST472
Alternative sequenceiVSP_0381031 – 338Missing in isoform 10. 1 PublicationAdd BLAST338
Alternative sequenceiVSP_0381041M → MHSPGADGTQVSPGAHYCSP TGAGCPRPCADTPGPQPQPM in isoform 5 and isoform 7. 2 Publications1
Alternative sequenceiVSP_0381051M → MHSPGAGCPRPCADTPGPQP QPM in isoform 6. 1 Publication1
Alternative sequenceiVSP_0381061M → MSDLRKRELGALFTSRGTGG VEWDGTQVSPGAHYCSPTGA GCPRPCADTPGPQPQPM in isoform 8. 1 Publication1
Alternative sequenceiVSP_008772227 – 263Missing in isoform 3 and isoform 7. 3 PublicationsAdd BLAST37
Alternative sequenceiVSP_007430227 – 256Missing in isoform 4. CuratedAdd BLAST30
Alternative sequenceiVSP_007431473 – 520LAQGG…LPFTT → MQACVGVRGVYPPGSMWVPA VAVLACSLQPRPWGVRTPWV PALTLAPA in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_038107892 – 952SKYWG…EPMNL → MGALTLSQIPGHGSSQQQAG GAFSRPGHPCRAAVVMVNTG AACSAWPPVQTPGCLECQGL TKKKWRQ in isoform 8. 1 PublicationAdd BLAST61

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF239243 mRNA Translation: AAF63491.1 Frameshift.
AY302468 mRNA Translation: AAQ18232.1
AY321367 mRNA Translation: AAP84704.1
BT009771 mRNA Translation: AAP88773.1
AK001032 mRNA Translation: BAA91474.1 Different initiation.
AK001190 mRNA Translation: BAA91545.1 Different initiation.
AK024469 mRNA Translation: BAB15759.1 Different initiation.
AK027781 mRNA Translation: BAB55363.1 Different initiation.
AK122588 mRNA Translation: BAC56929.1 Sequence problems.
AK128383 mRNA Translation: BAG54670.1
AK299292 mRNA Translation: BAG61307.1
AK301545 mRNA Translation: BAG63042.1
AK303481 mRNA Translation: BAG64517.1
AC004466 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57957.1
BC006453 mRNA Translation: AAH06453.2
BC020505 mRNA Translation: AAH20505.2
BC064840 mRNA Translation: AAH64840.1
AL117455 mRNA Translation: CAB55935.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41776.1 [Q8WUI4-7]
CCDS81685.1 [Q8WUI4-6]
CCDS8756.2 [Q8WUI4-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17245

NCBI Reference Sequences

More...
RefSeqi
NP_001091886.1, NM_001098416.3 [Q8WUI4-7]
NP_001295019.1, NM_001308090.1 [Q8WUI4-6]
NP_056216.2, NM_015401.4 [Q8WUI4-5]
XP_011536783.1, XM_011538481.1 [Q8WUI4-1]
XP_011536784.1, XM_011538482.1 [Q8WUI4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.200063

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000080059; ENSP00000080059; ENSG00000061273 [Q8WUI4-5]
ENST00000354334; ENSP00000351326; ENSG00000061273 [Q8WUI4-7]
ENST00000427332; ENSP00000404394; ENSG00000061273 [Q8WUI4-1]
ENST00000552960; ENSP00000448532; ENSG00000061273 [Q8WUI4-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51564

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51564

UCSC genome browser

More...
UCSCi
uc001rqj.5 human [Q8WUI4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF239243 mRNA Translation: AAF63491.1 Frameshift.
AY302468 mRNA Translation: AAQ18232.1
AY321367 mRNA Translation: AAP84704.1
BT009771 mRNA Translation: AAP88773.1
AK001032 mRNA Translation: BAA91474.1 Different initiation.
AK001190 mRNA Translation: BAA91545.1 Different initiation.
AK024469 mRNA Translation: BAB15759.1 Different initiation.
AK027781 mRNA Translation: BAB55363.1 Different initiation.
AK122588 mRNA Translation: BAC56929.1 Sequence problems.
AK128383 mRNA Translation: BAG54670.1
AK299292 mRNA Translation: BAG61307.1
AK301545 mRNA Translation: BAG63042.1
AK303481 mRNA Translation: BAG64517.1
AC004466 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57957.1
BC006453 mRNA Translation: AAH06453.2
BC020505 mRNA Translation: AAH20505.2
BC064840 mRNA Translation: AAH64840.1
AL117455 mRNA Translation: CAB55935.1
CCDSiCCDS41776.1 [Q8WUI4-7]
CCDS81685.1 [Q8WUI4-6]
CCDS8756.2 [Q8WUI4-5]
PIRiT17245
RefSeqiNP_001091886.1, NM_001098416.3 [Q8WUI4-7]
NP_001295019.1, NM_001308090.1 [Q8WUI4-6]
NP_056216.2, NM_015401.4 [Q8WUI4-5]
XP_011536783.1, XM_011538481.1 [Q8WUI4-1]
XP_011536784.1, XM_011538482.1 [Q8WUI4-1]
UniGeneiHs.200063

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3C0YX-ray2.10A/B/C482-903[»]
3C0ZX-ray2.10A/B/C482-903[»]
3C10X-ray2.00A/B/C482-903[»]
3ZNRX-ray2.40A/B/C482-903[»]
3ZNSX-ray2.45A/B/C482-903[»]
ProteinModelPortaliQ8WUI4
SMRiQ8WUI4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119613, 95 interactors
CORUMiQ8WUI4
DIPiDIP-29860N
IntActiQ8WUI4, 49 interactors
MINTiQ8WUI4
STRINGi9606.ENSP00000080059

Chemistry databases

BindingDBiQ8WUI4
ChEMBLiCHEMBL2716
DrugBankiDB05015 Belinostat
DB06603 Panobinostat
GuidetoPHARMACOLOGYi2661

PTM databases

iPTMnetiQ8WUI4
PhosphoSitePlusiQ8WUI4

Polymorphism and mutation databases

BioMutaiHDAC7
DMDMi30913097

Proteomic databases

EPDiQ8WUI4
MaxQBiQ8WUI4
PaxDbiQ8WUI4
PeptideAtlasiQ8WUI4
PRIDEiQ8WUI4
ProteomicsDBi74678
74679 [Q8WUI4-10]
74680 [Q8WUI4-2]
74681 [Q8WUI4-3]
74682 [Q8WUI4-4]
74683 [Q8WUI4-5]
74684 [Q8WUI4-6]
74685 [Q8WUI4-7]
74686 [Q8WUI4-8]
74687 [Q8WUI4-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51564
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000080059; ENSP00000080059; ENSG00000061273 [Q8WUI4-5]
ENST00000354334; ENSP00000351326; ENSG00000061273 [Q8WUI4-7]
ENST00000427332; ENSP00000404394; ENSG00000061273 [Q8WUI4-1]
ENST00000552960; ENSP00000448532; ENSG00000061273 [Q8WUI4-6]
GeneIDi51564
KEGGihsa:51564
UCSCiuc001rqj.5 human [Q8WUI4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51564
DisGeNETi51564
EuPathDBiHostDB:ENSG00000061273.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HDAC7

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0129669
HGNCiHGNC:14067 HDAC7
HPAiHPA004775
MIMi606542 gene
neXtProtiNX_Q8WUI4
OpenTargetsiENSG00000061273
PharmGKBiPA162390579

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1343 Eukaryota
COG0123 LUCA
GeneTreeiENSGT00940000159065
HOVERGENiHBG057100
InParanoidiQ8WUI4
KOiK11408
PhylomeDBiQ8WUI4
TreeFamiTF106174

Enzyme and pathway databases

BRENDAi3.5.1.98 2681
ReactomeiR-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription
R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants
R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-8943724 Regulation of PTEN gene transcription
SIGNORiQ8WUI4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HDAC7 human
EvolutionaryTraceiQ8WUI4

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HDAC7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51564
PMAP-CutDBiQ8WUI4

Protein Ontology

More...
PROi
PR:Q8WUI4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000061273 Expressed in 224 organ(s), highest expression level in left adrenal gland
CleanExiHS_HDAC7
ExpressionAtlasiQ8WUI4 baseline and differential
GenevisibleiQ8WUI4 HS

Family and domain databases

Gene3Di3.40.800.20, 1 hit
InterProiView protein in InterPro
IPR000286 His_deacetylse
IPR023801 His_deacetylse_dom
IPR037138 His_deacetylse_dom_sf
IPR017320 Histone_deAcase_II_euk
IPR023696 Ureohydrolase_dom_sf
PANTHERiPTHR10625 PTHR10625, 4 hits
PfamiView protein in Pfam
PF00850 Hist_deacetyl, 1 hit
PIRSFiPIRSF037911 HDAC_II_euk, 1 hit
PRINTSiPR01270 HDASUPER
SUPFAMiSSF52768 SSF52768, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHDAC7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WUI4
Secondary accession number(s): B3KY08
, B4DWI0, B4E0Q5, Q6P1W9, Q6W9G7, Q7Z4K2, Q7Z5I1, Q96K01, Q9BR73, Q9H7L0, Q9NW41, Q9NWA9, Q9NYK9, Q9UFU7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2003
Last sequence update: May 16, 2003
Last modified: December 5, 2018
This is version 182 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again