Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (22 Apr 2020)
Sequence version 2 (29 May 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein Churchill

Gene

CHURC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement (By similarity). Does not bind DNA by itself.By similarity

Caution

It is uncertain whether Met-1 or Met-28 is the initiator. Some orthologous sequences cannot be extended. The protein analyzed in PubMed:17610897 is derived from a construct starting at Met-28.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi29Zinc 11
Metal bindingi32Zinc 11
Metal bindingi57Zinc 11
Metal bindingi57Zinc 21
Metal bindingi60Zinc 21
Metal bindingi86Zinc 31
Metal bindingi88Zinc 21
Metal bindingi91Zinc 21
Metal bindingi93Zinc 11
Metal bindingi98Zinc 31
Metal bindingi115Zinc 31
Metal bindingi118Zinc 31

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein Churchill
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHURC1
Synonyms:C14orf52, CHCH
ORF Names:My015
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20099 CHURC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608577 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8WUH1

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
91612

Open Targets

More...
OpenTargetsi
ENSG00000258289

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134982480

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8WUH1 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CHURC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
510120833

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000896651 – 139Protein ChurchillAdd BLAST139

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8WUH1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8WUH1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8WUH1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8WUH1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8WUH1

PeptideAtlas

More...
PeptideAtlasi
Q8WUH1

PRoteomics IDEntifications database

More...
PRIDEi
Q8WUH1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
32466
32497
74674 [Q8WUH1-1]
74675 [Q8WUH1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8WUH1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8WUH1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000258289 Expressed in parietal pleura and 202 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8WUH1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8WUH1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000258289 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124853, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q8WUH1, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000475473

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8WUH1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1139
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8WUH1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8WUH1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Churchill family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IXR5 Eukaryota
ENOG411208Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011163

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8WUH1

Identification of Orthologs from Complete Genome Data

More...
OMAi
YLGCANC

TreeFam database of animal gene trees

More...
TreeFami
TF333004

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.160.500, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038543 Churchill_sf
IPR009508 Transcrpt_activator_Churchill

The PANTHER Classification System

More...
PANTHERi
PTHR31931 PTHR31931, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06573 Churchill, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WUH1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRQPYLSSRE VSSSRKRWRT FPVDCVAMCG DCVEKEYPNR GNTCLENGSF
60 70 80 90 100
LLNFTGCAVC SKRDFMLITN KSLKEEDGEE IVTYDHLCKN CHHVIARHEY
110 120 130
TFSIMDEFQE YTMLCLLCGK AEDTISILPD DPRQMTLLF
Length:139
Mass (Da):16,111
Last modified:May 29, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i16B578B7DBC53CF9
GO
Isoform 2 (identifier: Q8WUH1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     86-86: H → PD

Show »
Length:140
Mass (Da):16,187
Checksum:i01C9EA7F745A3954
GO
Isoform 3 (identifier: Q8WUH1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     86-139: HLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF → RVYHAVSVMRQSRRYYQYSP

Show »
Length:105
Mass (Da):12,286
Checksum:iF97F156E104D76D6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YHA3H0YHA3_HUMAN
Protein Churchill
CHURC1
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHB4H0YHB4_HUMAN
Protein Churchill
CHURC1
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YID9H0YID9_HUMAN
Protein Churchill
CHURC1
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGJ7A0A0C4DGJ7_HUMAN
Protein Churchill
CHURC1
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG43128 differs from that shown. Frameshift at positions=92 and translation N-terminally extended.Curated
The sequence AAH20550 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAG51943 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1 – 3Missing in AAH20550 (PubMed:15489334).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04650986 – 139HLCKN…MTLLF → RVYHAVSVMRQSRRYYQYSP in isoform 3. CuratedAdd BLAST54
Alternative sequenceiVSP_02102186H → PD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80884.1
CH471061 Genomic DNA Translation: EAW80887.1
BC020550 mRNA Translation: AAH20550.1 Different initiation.
AF060510 mRNA Translation: AAG43128.1 Sequence problems.
AK057626 mRNA Translation: BAG51943.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32101.2 [Q8WUH1-2]
CCDS55921.1 [Q8WUH1-1]
CCDS55922.1 [Q8WUH1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001190992.1, NM_001204063.1 [Q8WUH1-1]
NP_001190993.1, NM_001204064.1 [Q8WUH1-3]
NP_660148.3, NM_145165.3 [Q8WUH1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000548752; ENSP00000450165; ENSG00000258289 [Q8WUH1-3]
ENST00000549115; ENSP00000448050; ENSG00000258289 [Q8WUH1-1]
ENST00000607599; ENSP00000475473; ENSG00000258289 [Q8WUH1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
91612

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:91612

UCSC genome browser

More...
UCSCi
uc001xhv.4 human [Q8WUH1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL135745 Genomic DNA No translation available.
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80884.1
CH471061 Genomic DNA Translation: EAW80887.1
BC020550 mRNA Translation: AAH20550.1 Different initiation.
AF060510 mRNA Translation: AAG43128.1 Sequence problems.
AK057626 mRNA Translation: BAG51943.1 Different initiation.
CCDSiCCDS32101.2 [Q8WUH1-2]
CCDS55921.1 [Q8WUH1-1]
CCDS55922.1 [Q8WUH1-3]
RefSeqiNP_001190992.1, NM_001204063.1 [Q8WUH1-1]
NP_001190993.1, NM_001204064.1 [Q8WUH1-3]
NP_660148.3, NM_145165.3 [Q8WUH1-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JOXNMR-A29-134[»]
SMRiQ8WUH1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi124853, 11 interactors
IntActiQ8WUH1, 3 interactors
STRINGi9606.ENSP00000475473

PTM databases

iPTMnetiQ8WUH1
PhosphoSitePlusiQ8WUH1

Polymorphism and mutation databases

BioMutaiCHURC1
DMDMi510120833

Proteomic databases

EPDiQ8WUH1
jPOSTiQ8WUH1
MassIVEiQ8WUH1
MaxQBiQ8WUH1
PaxDbiQ8WUH1
PeptideAtlasiQ8WUH1
PRIDEiQ8WUH1
ProteomicsDBi32466
32497
74674 [Q8WUH1-1]
74675 [Q8WUH1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
51632 55 antibodies

Genome annotation databases

EnsembliENST00000548752; ENSP00000450165; ENSG00000258289 [Q8WUH1-3]
ENST00000549115; ENSP00000448050; ENSG00000258289 [Q8WUH1-1]
ENST00000607599; ENSP00000475473; ENSG00000258289 [Q8WUH1-2]
GeneIDi91612
KEGGihsa:91612
UCSCiuc001xhv.4 human [Q8WUH1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
91612
DisGeNETi91612

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CHURC1
HGNCiHGNC:20099 CHURC1
HPAiENSG00000258289 Low tissue specificity
MIMi608577 gene
neXtProtiNX_Q8WUH1
OpenTargetsiENSG00000258289
PharmGKBiPA134982480

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IXR5 Eukaryota
ENOG411208Z LUCA
GeneTreeiENSGT00390000011163
InParanoidiQ8WUH1
OMAiYLGCANC
TreeFamiTF333004

Miscellaneous databases

EvolutionaryTraceiQ8WUH1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
91612
PharosiQ8WUH1 Tdark

Protein Ontology

More...
PROi
PR:Q8WUH1
RNActiQ8WUH1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000258289 Expressed in parietal pleura and 202 other tissues
ExpressionAtlasiQ8WUH1 baseline and differential
GenevisibleiQ8WUH1 HS

Family and domain databases

Gene3Di3.30.160.500, 1 hit
InterProiView protein in InterPro
IPR038543 Churchill_sf
IPR009508 Transcrpt_activator_Churchill
PANTHERiPTHR31931 PTHR31931, 1 hit
PfamiView protein in Pfam
PF06573 Churchill, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHUR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WUH1
Secondary accession number(s): B3KQ81
, G3V1X3, G3V214, Q9H3K7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2003
Last sequence update: May 29, 2013
Last modified: April 22, 2020
This is version 152 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again