Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8WU79 (SMAP2_HUMAN)

Entry version 166 (02 Jun 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Stromal membrane-associated protein 2

Gene

SMAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase activating protein that acts on ARF1. Can also activate ARF6 (in vitro). May play a role in clathrin-dependent retrograde transport from early endosomes to the trans-Golgi network (By similarity).

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri28 – 51C4-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8WU79

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Stromal membrane-associated protein 2
Alternative name(s):
Stromal membrane-associated protein 1-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SMAP2
Synonyms:SMAP1L
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25082, SMAP2

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8WU79

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000084070.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		64744

Open Targets

More...OpenTargetsi		ENSG00000084070

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162403939

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8WU79, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SMAP2

Domain mapping of disease mutations (DMDM)

More...DMDMi		74760545

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002358411 – 429Stromal membrane-associated protein 2Add BLAST429

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei127PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei225PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1
Modified residuei240PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8WU79

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8WU79

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8WU79

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8WU79

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8WU79

PeptideAtlas

More...PeptideAtlasi		Q8WU79

PRoteomics IDEntifications database

More...PRIDEi		Q8WU79

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		74642 [Q8WU79-1]
74643 [Q8WU79-2]
74644 [Q8WU79-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8WU79, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8WU79

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8WU79

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000084070, Expressed in blood and 201 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8WU79, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8WU79, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000084070, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ARF1.

Interacts with PICALM and clathrin heavy chains (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		122260, 143 interactors

Protein interaction database and analysis system

More...IntActi		Q8WU79, 33 interactors

Molecular INTeraction database

More...MINTi		Q8WU79

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000361803

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8WU79, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1429
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8WU79

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8WU79

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini13 – 137Arf-GAPPROSITE-ProRule annotationAdd BLAST125

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni138 – 184DisorderedSequence analysisAdd BLAST47
Regioni163 – 232Interaction with clathrin heavy chainsBy similarityAdd BLAST70
Regioni217 – 259DisorderedSequence analysisAdd BLAST43
Regioni340 – 429Interaction with PICALMBy similarityAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi138 – 174Basic and acidic residuesSequence analysisAdd BLAST37

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri28 – 51C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0703, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158387

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_023062_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8WU79

Identification of Orthologs from Complete Genome Data

More...OMAi		QWNIAQM

Database of Orthologous Groups

More...OrthoDBi		1097163at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8WU79

TreeFam database of animal gene trees

More...TreeFami		TF313876

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.40.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037278, ARFGAP/RecO
IPR001164, ArfGAP_dom
IPR038508, ArfGAP_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01412, ArfGap, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00405, REVINTRACTNG

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00105, ArfGap, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57863, SSF57863, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50115, ARFGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8WU79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGKSVKDVD RYQAVLANLL LEEDNKFCAD CQSKGPRWAS WNIGVFICIR 
        60         70         80         90        100
CAGIHRNLGV HISRVKSVNL DQWTQEQIQC MQEMGNGKAN RLYEAYLPET 
       110        120        130        140        150
FRRPQIDPAV EGFIRDKYEK KKYMDRSLDI NAFRKEKDDK WKRGSEPVPE 
       160        170        180        190        200
KKLEPVVFEK VKMPQKKEDP QLPRKSSPKS TAPVMDLLGL DAPVACSIAN 
       210        220        230        240        250
SKTSNTLEKD LDLLASVPSP SSSGSRKVVG SMPTAGSAGS VPENLNLFPE 
       260        270        280        290        300
PGSKSEEIGK KQLSKDSILS LYGSQTPQMP TQAMFMAPAQ MAYPTAYPSF 
       310        320        330        340        350
PGVTPPNSIM GSMMPPPVGM VAQPGASGMV APMAMPAGYM GGMQASMMGV 
       360        370        380        390        400
PNGMMTTQQA GYMAGMAAMP QTVYGVQPAQ QLQWNLTQMT QQMAGMNFYG 
       410        420 
ANGMMNYGQS MSGGNGQAAN QTLSPQMWK
Length:429
Mass (Da):46,786
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC2787BECAE37D6BD
GO
Isoform 2 (identifier: Q8WU79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQS → MIF

Show »
Length:399
Mass (Da):43,490
Checksum:iA34167C6814FBC63
GO
Isoform 3 (identifier: Q8WU79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:349
Mass (Da):37,697
Checksum:i113469E141B4ED20
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WV97A0A087WV97_HUMAN
Stromal membrane-associated protein...
SMAP2
424Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6RCC3X6RCC3_HUMAN
Stromal membrane-associated protein...
SMAP2
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048327289A → T. Corresponds to variant dbSNP:rs34845213Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0437891 – 80Missing in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_0185041 – 33MTGKS…ADCQS → MIF in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL133206 mRNA Translation: CAB61580.1
AL137764 mRNA Translation: CAB70912.1
AK298702 mRNA Translation: BAH12851.1
AK303975 mRNA Translation: BAH14088.1
AK313105 mRNA Translation: BAG35928.1
AK316218 mRNA Translation: BAH14589.1
AL031985 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07220.1
CH471059 Genomic DNA Translation: EAX07222.1
CH471059 Genomic DNA Translation: EAX07221.1
BC014512 mRNA Translation: AAH14512.1
BC021133 mRNA Translation: AAH21133.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS451.1 [Q8WU79-1]
CCDS55592.1 [Q8WU79-2]
CCDS55593.1 [Q8WU79-3]

NCBI Reference Sequences

More...RefSeqi		NP_001185907.1, NM_001198978.1 [Q8WU79-2]
NP_001185908.1, NM_001198979.1
NP_001185909.1, NM_001198980.1 [Q8WU79-3]
NP_073570.1, NM_022733.2 [Q8WU79-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000372708; ENSP00000361793; ENSG00000084070 [Q8WU79-2]
ENST00000372718; ENSP00000361803; ENSG00000084070 [Q8WU79-1]
ENST00000539317; ENSP00000442835; ENSG00000084070 [Q8WU79-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		64744

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:64744

UCSC genome browser

More...UCSCi		uc001cfj.4, human [Q8WU79-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL133206 mRNA Translation: CAB61580.1
AL137764 mRNA Translation: CAB70912.1
AK298702 mRNA Translation: BAH12851.1
AK303975 mRNA Translation: BAH14088.1
AK313105 mRNA Translation: BAG35928.1
AK316218 mRNA Translation: BAH14589.1
AL031985 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07220.1
CH471059 Genomic DNA Translation: EAX07222.1
CH471059 Genomic DNA Translation: EAX07221.1
BC014512 mRNA Translation: AAH14512.1
BC021133 mRNA Translation: AAH21133.1
CCDSiCCDS451.1 [Q8WU79-1]
CCDS55592.1 [Q8WU79-2]
CCDS55593.1 [Q8WU79-3]
RefSeqiNP_001185907.1, NM_001198978.1 [Q8WU79-2]
NP_001185908.1, NM_001198979.1
NP_001185909.1, NM_001198980.1 [Q8WU79-3]
NP_073570.1, NM_022733.2 [Q8WU79-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2IQJX-ray1.90A/B1-132[»]
SMRiQ8WU79
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi122260, 143 interactors
IntActiQ8WU79, 33 interactors
MINTiQ8WU79
STRINGi9606.ENSP00000361803

PTM databases

GlyGeniQ8WU79, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ8WU79
PhosphoSitePlusiQ8WU79

Genetic variation databases

BioMutaiSMAP2
DMDMi74760545

Proteomic databases

EPDiQ8WU79
jPOSTiQ8WU79
MassIVEiQ8WU79
MaxQBiQ8WU79
PaxDbiQ8WU79
PeptideAtlasiQ8WU79
PRIDEiQ8WU79
ProteomicsDBi74642 [Q8WU79-1]
74643 [Q8WU79-2]
74644 [Q8WU79-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		17974, 129 antibodies

The DNASU plasmid repository

More...DNASUi		64744

Genome annotation databases

EnsembliENST00000372708; ENSP00000361793; ENSG00000084070 [Q8WU79-2]
ENST00000372718; ENSP00000361803; ENSG00000084070 [Q8WU79-1]
ENST00000539317; ENSP00000442835; ENSG00000084070 [Q8WU79-3]
GeneIDi64744
KEGGihsa:64744
UCSCiuc001cfj.4, human [Q8WU79-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		64744
DisGeNETi64744

GeneCards: human genes, protein and diseases

More...GeneCardsi		SMAP2
HGNCiHGNC:25082, SMAP2
HPAiENSG00000084070, Tissue enhanced (lymphoid)
neXtProtiNX_Q8WU79
OpenTargetsiENSG00000084070
PharmGKBiPA162403939
VEuPathDBiHostDB:ENSG00000084070.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0703, Eukaryota
GeneTreeiENSGT00940000158387
HOGENOMiCLU_023062_5_0_1
InParanoidiQ8WU79
OMAiQWNIAQM
OrthoDBi1097163at2759
PhylomeDBiQ8WU79
TreeFamiTF313876

Enzyme and pathway databases

PathwayCommonsiQ8WU79

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		64744, 4 hits in 945 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SMAP2, human
EvolutionaryTraceiQ8WU79

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		64744
PharosiQ8WU79, Tbio

Protein Ontology

More...PROi		PR:Q8WU79
RNActiQ8WU79, protein

Gene expression databases

BgeeiENSG00000084070, Expressed in blood and 201 other tissues
ExpressionAtlasiQ8WU79, baseline and differential
GenevisibleiQ8WU79, HS

Family and domain databases

Gene3Di3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278, ARFGAP/RecO
IPR001164, ArfGAP_dom
IPR038508, ArfGAP_dom_sf
PfamiView protein in Pfam
PF01412, ArfGap, 1 hit
PRINTSiPR00405, REVINTRACTNG
SMARTiView protein in SMART
SM00105, ArfGap, 1 hit
SUPFAMiSSF57863, SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115, ARFGAP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSMAP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WU79
Secondary accession number(s): B2R7T1
, B7Z5B5, B7Z8V2, D3DPV2, Q5QPL2, Q96C93, Q9NST2, Q9UJL8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: March 1, 2002
Last modified: June 2, 2021
This is version 166 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again