Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8WTV0 (SCRB1_HUMAN)

Entry version 183 (02 Dec 2020)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Scavenger receptor class B member 1

Gene

SCARB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells (PubMed:12016218, PubMed:12519372, PubMed:21226579). Receptor for HDL, mediating selective uptake of cholesteryl ether and HDL-dependent cholesterol efflux (PubMed:26965621). Also facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins, although less efficiently than HDL. May be involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity (PubMed:12016218).5 Publications
(Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes and appears to facilitate its cell entry (PubMed:12356718, PubMed:12913001, PubMed:18000990). Binding between SCARB1 and the hepatitis C virus glycoprotein E2 is independent of the genotype of the viral isolate (PubMed:12356718). Mediates uptake of M.fortuitum, E.coli and S.aureus (PubMed:16020694).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processHost-virus interaction

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8WTV0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3000471, Scavenging by Class B Receptors [Q8WTV0-2]
R-HSA-8964011, HDL clearance [Q8WTV0-2]

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8WTV0

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.39.1.3, the long chain fatty acid translocase (lcfat) family

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001519

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Scavenger receptor class B member 1
Short name:
SRB1
Alternative name(s):
CD36 and LIMPII analogous 1
Short name:
CLA-1
CD36 antigen-like 1
Collagen type I receptor, thrombospondin receptor-like 1
SR-BI
CD_antigen: CD36
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SCARB1
Synonyms:CD36L1, CLA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000073060.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:1664, SCARB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601040, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8WTV0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 11CytoplasmicSequence analysisAdd BLAST11
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 32HelicalSequence analysisAdd BLAST21
Topological domaini33 – 443ExtracellularSequence analysisAdd BLAST411
Transmembranei444 – 464HelicalSequence analysisAdd BLAST21
Topological domaini465 – 552CytoplasmicSequence analysisAdd BLAST88

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		949

MalaCards human disease database

More...MalaCardsi		SCARB1
MIMi610762, phenotype

Open Targets

More...OpenTargetsi		ENSG00000073060

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA97

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8WTV0, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1914272

Drug and drug target database

More...DrugBanki		DB14003, alpha-Tocopherol acetate
DB00144, Phosphatidyl serine
DB11635, Tocofersolan
DB11251, Tocopherol
DB00163, Vitamin E

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SCARB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		37999904

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001441601 – 552Scavenger receptor class B member 1Add BLAST552

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi102N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi108N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi173N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi212N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi227N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi251 ↔ 384By similarity
Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi310N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi330N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi462S-palmitoyl cysteineBy similarity1
Isoform 2 (identifier: Q8WTV0-3)
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei393PhosphoserineCombined sources1
Isoform 4 (identifier: Q8WTV0-4)
Modified residuei458PhosphoserineCombined sources1
Isoform 1 (identifier: Q8WTV0-2)
Modified residuei493PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.2 Publications
The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8WTV0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8WTV0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8WTV0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8WTV0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8WTV0

PeptideAtlas

More...PeptideAtlasi		Q8WTV0

PRoteomics IDEntifications database

More...PRIDEi		Q8WTV0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		30176
74602 [Q8WTV0-1]
74603 [Q8WTV0-2]
74604 [Q8WTV0-3]
74605 [Q8WTV0-4]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1722, 1 N-Linked glycan (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8WTV0, 12 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8WTV0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8WTV0

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8WTV0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000073060, Expressed in adrenal gland and 205 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8WTV0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8WTV0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000073060, Tissue enhanced (adrenal gland, liver, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The C-terminal region binds to PDZK1.

By similarity

(Microbial infection) Interacts with hepatitis C virus E1:E2 glycoproteins.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107387, 48 interactors

Protein interaction database and analysis system

More...IntActi		Q8WTV0, 38 interactors

Molecular INTeraction database

More...MINTi		Q8WTV0

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000261693

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q8WTV0

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8WTV0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8WTV0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CD36 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3776, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153372

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8WTV0

Identification of Orthologs from Complete Genome Data

More...OMAi		FKGVPTY

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8WTV0

TreeFam database of animal gene trees

More...TreeFami		TF317925

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005428, CD36/SCARB1/SNMP1
IPR002159, CD36_fam

The PANTHER Classification System

More...PANTHERi		PTHR11923, PTHR11923, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01130, CD36, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01610, CD36ANTIGEN
PR01609, CD36FAMILY

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q8WTV0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS 
        60         70         80         90        100
LSFNMWKEIP IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK 
       110        120        130        140        150
SNITFNNNDT VSFLEYRTFQ FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN 
       160        170        180        190        200
KPMTLKLIMT LAFTTLGERA FMNRTVGEIM WGYKDPLVNL INKYFPGMFP 
       210        220        230        240        250
FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL SKVDFWHSDQ 
       260        270        280        290        300
CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR 
       310        320        330        340        350
FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA 
       360        370        380        390        400
DPVLAEAVTG LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI 
       410        420        430        440        450
GQTGKIEPVV LPLLWFAESG AMEGETLHTF YTQLVLMPKV MHYAQYVLLA 
       460        470        480        490        500
LGCVLLLVPV ICQIRSQVGA GQRAARADSH SLACWGKGAS DRTLWPTAAW 
       510        520        530        540        550
SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE GLGPSLGGGT 

GS
Note: May be due to a competing donor splice site.
Length:552
Mass (Da):60,878
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i06B0BD771FEA284F
GO
Isoform 1 (identifier: Q8WTV0-2) [UniParc]FASTAAdd to basket
Also known as: SR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:509
Mass (Da):56,973
Checksum:i0184AE9CEC595374
GO
Isoform 2 (identifier: Q8WTV0-3) [UniParc]FASTAAdd to basket
Also known as: SR-BII

The sequence of this isoform differs from the canonical sequence as follows:
     43-142: Missing.
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:409
Mass (Da):45,103
Checksum:i88B30340CD403541
GO
Isoform 4 (identifier: Q8WTV0-4) [UniParc]FASTAAdd to basket
Also known as: SR-BIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:474
Mass (Da):53,579
Checksum:i1CF55DEB32EF3D3B
GO
Isoform 5 (identifier: Q8WTV0-5) [UniParc]FASTAAdd to basket
Also known as: SR-BI.21 Publication, SR-BII1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA

Show »
Length:506
Mass (Da):56,170
Checksum:i73C1ED23924F2B49
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H4X0F5H4X0_HUMAN
Scavenger receptor class B member 1
SCARB1
499Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZKQ9B7ZKQ9_HUMAN
SCARB1 protein
SCARB1
481Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5E8F5H5E8_HUMAN
Scavenger receptor class B member 1
SCARB1
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti70F → L in AAQ08185 (Ref. 2) Curated1
Sequence conflicti97F → S in CAA80277 (PubMed:7689561).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIMi:610762].3 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0170982G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. 2 PublicationsCorresponds to variant dbSNP:rs4238001Ensembl.1
Natural variantiVAR_017099135V → I1 PublicationCorresponds to variant dbSNP:rs5891Ensembl.1
Natural variantiVAR_017100167G → S1 PublicationCorresponds to variant dbSNP:rs199588922Ensembl.1
Natural variantiVAR_019507229S → G. Corresponds to variant dbSNP:rs10396213Ensembl.1
Natural variantiVAR_064909297P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. 1 PublicationCorresponds to variant dbSNP:rs387906791EnsemblClinVar.1
Natural variantiVAR_076314376P → L Rare variant; associated with high HDL-cholesterol levels and increased risk for coronary heart disease; results in highly reduced cholesterol uptake from HDL; markedly reduced localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs74830677EnsemblClinVar.1
Natural variantiVAR_017101511C → R. Corresponds to variant dbSNP:rs2293440Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0110371 – 42MGCSA…QQVLK → MALQPSW in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_00855343 – 142Missing in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_008554468 – 552VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4. 3 PublicationsAdd BLAST85
Alternative sequenceiVSP_054083468 – 552VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5. CuratedAdd BLAST85

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z22555 mRNA Translation: CAA80277.1
AF515445 mRNA Translation: AAQ08185.1
AC073593 Genomic DNA No translation available.
AC126309 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98459.1
BC022087 mRNA No translation available.
BC080647 mRNA Translation: AAH80647.1
BC093732 mRNA Translation: AAH93732.1
BC112037 mRNA Translation: AAI12038.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45008.1 [Q8WTV0-5]
CCDS9259.1 [Q8WTV0-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S36656, A48528

NCBI Reference Sequences

More...RefSeqi		NP_001076428.1, NM_001082959.1 [Q8WTV0-5]
NP_005496.4, NM_005505.4 [Q8WTV0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000261693; ENSP00000261693; ENSG00000073060 [Q8WTV0-2]
ENST00000339570; ENSP00000343795; ENSG00000073060 [Q8WTV0-5]
ENST00000415380; ENSP00000414979; ENSG00000073060 [Q8WTV0-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		949

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:949

UCSC genome browser

More...UCSCi		uc001ugm.5, human [Q8WTV0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22555 mRNA Translation: CAA80277.1
AF515445 mRNA Translation: AAQ08185.1
AC073593 Genomic DNA No translation available.
AC126309 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98459.1
BC022087 mRNA No translation available.
BC080647 mRNA Translation: AAH80647.1
BC093732 mRNA Translation: AAH93732.1
BC112037 mRNA Translation: AAI12038.1
CCDSiCCDS45008.1 [Q8WTV0-5]
CCDS9259.1 [Q8WTV0-2]
PIRiS36656, A48528
RefSeqiNP_001076428.1, NM_001082959.1 [Q8WTV0-5]
NP_005496.4, NM_005505.4 [Q8WTV0-2]

3D structure databases

SMRiQ8WTV0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107387, 48 interactors
IntActiQ8WTV0, 38 interactors
MINTiQ8WTV0
STRINGi9606.ENSP00000261693

Chemistry databases

BindingDBiQ8WTV0
ChEMBLiCHEMBL1914272
DrugBankiDB14003, alpha-Tocopherol acetate
DB00144, Phosphatidyl serine
DB11635, Tocofersolan
DB11251, Tocopherol
DB00163, Vitamin E
SwissLipidsiSLP:000001519

Protein family/group databases

TCDBi9.B.39.1.3, the long chain fatty acid translocase (lcfat) family

PTM databases

GlyConnecti1722, 1 N-Linked glycan (1 site)
GlyGeniQ8WTV0, 12 sites
iPTMnetiQ8WTV0
PhosphoSitePlusiQ8WTV0
SwissPalmiQ8WTV0

Polymorphism and mutation databases

BioMutaiSCARB1
DMDMi37999904

Proteomic databases

EPDiQ8WTV0
jPOSTiQ8WTV0
MassIVEiQ8WTV0
MaxQBiQ8WTV0
PaxDbiQ8WTV0
PeptideAtlasiQ8WTV0
PRIDEiQ8WTV0
ProteomicsDBi30176
74602 [Q8WTV0-1]
74603 [Q8WTV0-2]
74604 [Q8WTV0-3]
74605 [Q8WTV0-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31879, 592 antibodies

The DNASU plasmid repository

More...DNASUi		949

Genome annotation databases

EnsembliENST00000261693; ENSP00000261693; ENSG00000073060 [Q8WTV0-2]
ENST00000339570; ENSP00000343795; ENSG00000073060 [Q8WTV0-5]
ENST00000415380; ENSP00000414979; ENSG00000073060 [Q8WTV0-1]
GeneIDi949
KEGGihsa:949
UCSCiuc001ugm.5, human [Q8WTV0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		949
DisGeNETi949
EuPathDBiHostDB:ENSG00000073060.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		SCARB1
HGNCiHGNC:1664, SCARB1
HPAiENSG00000073060, Tissue enhanced (adrenal gland, liver, placenta)
MalaCardsiSCARB1
MIMi601040, gene
610762, phenotype
neXtProtiNX_Q8WTV0
OpenTargetsiENSG00000073060
PharmGKBiPA97

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3776, Eukaryota
GeneTreeiENSGT00940000153372
InParanoidiQ8WTV0
OMAiFKGVPTY
PhylomeDBiQ8WTV0
TreeFamiTF317925

Enzyme and pathway databases

PathwayCommonsiQ8WTV0
ReactomeiR-HSA-3000471, Scavenging by Class B Receptors [Q8WTV0-2]
R-HSA-8964011, HDL clearance [Q8WTV0-2]
SIGNORiQ8WTV0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		949, 6 hits in 845 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SCARB1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SCARB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		949
PharosiQ8WTV0, Tchem

Protein Ontology

More...PROi		PR:Q8WTV0
RNActiQ8WTV0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000073060, Expressed in adrenal gland and 205 other tissues
ExpressionAtlasiQ8WTV0, baseline and differential
GenevisibleiQ8WTV0, HS

Family and domain databases

InterProiView protein in InterPro
IPR005428, CD36/SCARB1/SNMP1
IPR002159, CD36_fam
PANTHERiPTHR11923, PTHR11923, 1 hit
PfamiView protein in Pfam
PF01130, CD36, 1 hit
PRINTSiPR01610, CD36ANTIGEN
PR01609, CD36FAMILY

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCRB1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8WTV0
Secondary accession number(s): F8W8N0
, Q14016, Q52LZ5, Q6KFX4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: March 1, 2002
Last modified: December 2, 2020
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again