Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q8VYA5 (RSZ33_ARATH)

Entry version 144 (29 Sep 2021)
Sequence version 1 (01 Mar 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Serine/arginine-rich splicing factor RS2Z33

Gene

RS2Z33

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Splicing factor involved in constitutive and/or alternative splicing. Regulates the splicing of its own pre-mRNA and the alternative splicing of RS30, RS31 and RS34. Associates the cyclin-dependent kinase G1 (CDKG1) with the spliceosome and recruits it to U1 snRNP to facilitate splicing.

3 Publications

Miscellaneous

The splicing pattern of the pre-mRNA is regulated in a tissue-specific manner and by development, and changes in response to various types of abiotic stresses (PubMed:17319848), but is not affected by the light/dark regimes (PubMed:24763593).2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri99 – 116CCHC-type 1PROSITE-ProRule annotationAdd BLAST18
Zinc fingeri121 – 138CCHC-type 2PROSITE-ProRule annotationAdd BLAST18

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA processing, mRNA splicing
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/arginine-rich splicing factor RS2Z33
Alternative name(s):
RS-containing zinc finger protein 33
Short name:
At-RS2Z33
Short name:
At-RSZ33
Short name:
AtRSZ33
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RS2Z33
Synonyms:RSZ33
Ordered Locus Names:At2g37340
ORF Names:F3G5.13
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliopsida › eudicotyledons › Gunneridae › Pentapetalae › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...Araporti		AT2G37340

The Arabidopsis Information Resource

More...TAIRi		locus:2049766, AT2G37340

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus, Spliceosome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004169981 – 290Serine/arginine-rich splicing factor RS2Z33Add BLAST290

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei164PhosphoserineBy similarity1
Modified residuei166PhosphoserineBy similarity1
Modified residuei180PhosphoserineBy similarity1
Modified residuei202PhosphoserineCombined sources1
Modified residuei204PhosphoserineCombined sources1
Modified residuei211PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1
Modified residuei230PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei256PhosphoserineCombined sources1
Modified residuei271PhosphoserineBy similarity1
Modified residuei283PhosphoserineBy similarity1
Modified residuei287PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Extensively phosphorylated on serine residues in the RS domain.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8VYA5

PRoteomics IDEntifications database

More...PRIDEi		Q8VYA5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		226631 [Q8VYA5-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8VYA5

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q8VYA5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in roots, flowers, anthers, pollen, ovules, style and developing seeds. Not detected in stems or leaves.2 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8VYA5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8VYA5, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the spliceosome.

Interacts with SNRNP35, CDKG1, cyp59, SR33, SR34, RSZ21, RSZ22, SCL28, SCL30, SCL30A, SCL33 and SC35 (PubMed:10593939, PubMed:12176998, PubMed:15987817, PubMed:16497658, PubMed:23404887).

Interacts with MOS14 (PubMed:21738492).

6 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		3655, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q8VYA5, 11 interactors

STRING: functional protein association networks

More...STRINGi		3702.AT2G37340.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8VYA5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini11 – 81RRMPROSITE-ProRule annotationAdd BLAST71

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni135 – 290DisorderedSequence analysisAdd BLAST156

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi179 – 217Basic and acidic residuesSequence analysisAdd BLAST39
Compositional biasi267 – 282Basic and acidic residuesSequence analysisAdd BLAST16

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the splicing factor SR family. RS2Z subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri99 – 116CCHC-type 1PROSITE-ProRule annotationAdd BLAST18
Zinc fingeri121 – 138CCHC-type 2PROSITE-ProRule annotationAdd BLAST18

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0107, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_047187_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8VYA5

Identification of Orthologs from Complete Genome Data

More...OMAi		KCATHGG

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8VYA5

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR000504, RRM_dom
IPR001878, Znf_CCHC
IPR036875, Znf_CCHC_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00076, RRM_1, 1 hit
PF00098, zf-CCHC, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360, RRM, 1 hit
SM00343, ZnF_C2HC, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928, SSF54928, 1 hit
SSF57756, SSF57756, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50102, RRM, 1 hit
PS50158, ZF_CCHC, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8VYA5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRYDDRYGN TRLYVGRLSS RTRTRDLERL FSRYGRVRDV DMKRDYAFVE 
        60         70         80         90        100
FGDPRDADDA RHYLDGRDFD GSRITVEFSR GAPRGSRDFD SRGPPPGAGR 
       110        120        130        140        150
CFNCGVDGHW ARDCTAGDWK NKCYRCGERG HIERNCKNSP KKLRRSGSYS 
       160        170        180        190        200
RSPVRSRSPR RRRSPSRSLS RSRSYSRSRS PVRRRERSVE ERSRSPKRMD 
       210        220        230        240        250
DSLSPRARDR SPVLDDEGSP KIIDGSPPPS PKLQKEVGSD RDGGSPQDNG 
       260        270        280        290
RNSVVSPVVG AGGDSSKEDR SPVDDDYEPN RTSPRGSESP
Length:290
Mass (Da):32,893
Last modified:March 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4B0407A7E106EFA2
GO
Isoform 2 (identifier: Q8VYA5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFV → MWENTPCMWSLLSSHFRNQ

Show »
Length:260
Mass (Da):29,181
Checksum:i9C210039D2FEC5D8
GO
Isoform 3 (identifier: Q8VYA5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:249
Mass (Da):27,842
Checksum:i3D02A5543D21CD02
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BX842467 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50E → V in BAD44429 (Ref. 6) Curated1
Sequence conflicti139S → Q in CAC03605 (PubMed:12176998).Curated1
Sequence conflicti173R → G in CAC03605 (PubMed:12176998).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0431121 – 49MPRYD…DYAFV → MWENTPCMWSLLSSHFRNQ in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_0431131 – 41Missing in isoform 3. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ293801 mRNA Translation: CAC03605.1
AC005896 Genomic DNA Translation: AAC98054.1
CP002685 Genomic DNA Translation: AEC09385.1
CP002685 Genomic DNA Translation: AEC09386.1
CP002685 Genomic DNA Translation: AEC09387.1
CP002685 Genomic DNA Translation: ANM63217.1
CP002685 Genomic DNA Translation: ANM63218.1
CP002685 Genomic DNA Translation: ANM63219.1
AY072315 mRNA Translation: AAL61922.1
AY114563 mRNA Translation: AAM47882.1
AK176551 mRNA Translation: BAD44314.1
BX842463 mRNA No translation available.
BX842467 mRNA No translation available.
AK176666 mRNA Translation: BAD44429.1

Protein sequence database of the Protein Information Resource

More...PIRi		F84791

NCBI Reference Sequences

More...RefSeqi		NP_001325321.1, NM_001336655.1 [Q8VYA5-2]
NP_001325322.1, NM_001336653.1 [Q8VYA5-2]
NP_001325323.1, NM_001336654.1 [Q8VYA5-3]
NP_850280.1, NM_179949.3 [Q8VYA5-1]
NP_973619.1, NM_201890.2 [Q8VYA5-2]
NP_973620.1, NM_201891.2 [Q8VYA5-3]

Genome annotation databases

Ensembl plant genome annotation project

More...EnsemblPlantsi		AT2G37340.1; AT2G37340.1; AT2G37340 [Q8VYA5-1]
AT2G37340.2; AT2G37340.2; AT2G37340 [Q8VYA5-2]
AT2G37340.3; AT2G37340.3; AT2G37340 [Q8VYA5-3]
AT2G37340.4; AT2G37340.4; AT2G37340 [Q8VYA5-2]
AT2G37340.5; AT2G37340.5; AT2G37340 [Q8VYA5-3]
AT2G37340.6; AT2G37340.6; AT2G37340 [Q8VYA5-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		818311

Gramene; a comparative resource for plants

More...Gramenei		AT2G37340.1; AT2G37340.1; AT2G37340 [Q8VYA5-1]
AT2G37340.2; AT2G37340.2; AT2G37340 [Q8VYA5-2]
AT2G37340.3; AT2G37340.3; AT2G37340 [Q8VYA5-3]
AT2G37340.4; AT2G37340.4; AT2G37340 [Q8VYA5-2]
AT2G37340.5; AT2G37340.5; AT2G37340 [Q8VYA5-3]
AT2G37340.6; AT2G37340.6; AT2G37340 [Q8VYA5-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		ath:AT2G37340

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ293801 mRNA Translation: CAC03605.1
AC005896 Genomic DNA Translation: AAC98054.1
CP002685 Genomic DNA Translation: AEC09385.1
CP002685 Genomic DNA Translation: AEC09386.1
CP002685 Genomic DNA Translation: AEC09387.1
CP002685 Genomic DNA Translation: ANM63217.1
CP002685 Genomic DNA Translation: ANM63218.1
CP002685 Genomic DNA Translation: ANM63219.1
AY072315 mRNA Translation: AAL61922.1
AY114563 mRNA Translation: AAM47882.1
AK176551 mRNA Translation: BAD44314.1
BX842463 mRNA No translation available.
BX842467 mRNA No translation available.
AK176666 mRNA Translation: BAD44429.1
PIRiF84791
RefSeqiNP_001325321.1, NM_001336655.1 [Q8VYA5-2]
NP_001325322.1, NM_001336653.1 [Q8VYA5-2]
NP_001325323.1, NM_001336654.1 [Q8VYA5-3]
NP_850280.1, NM_179949.3 [Q8VYA5-1]
NP_973619.1, NM_201890.2 [Q8VYA5-2]
NP_973620.1, NM_201891.2 [Q8VYA5-3]

3D structure databases

SMRiQ8VYA5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi3655, 16 interactors
IntActiQ8VYA5, 11 interactors
STRINGi3702.AT2G37340.1

PTM databases

iPTMnetiQ8VYA5
MetOSiteiQ8VYA5

Proteomic databases

PaxDbiQ8VYA5
PRIDEiQ8VYA5
ProteomicsDBi226631 [Q8VYA5-1]

Genome annotation databases

EnsemblPlantsiAT2G37340.1; AT2G37340.1; AT2G37340 [Q8VYA5-1]
AT2G37340.2; AT2G37340.2; AT2G37340 [Q8VYA5-2]
AT2G37340.3; AT2G37340.3; AT2G37340 [Q8VYA5-3]
AT2G37340.4; AT2G37340.4; AT2G37340 [Q8VYA5-2]
AT2G37340.5; AT2G37340.5; AT2G37340 [Q8VYA5-3]
AT2G37340.6; AT2G37340.6; AT2G37340 [Q8VYA5-2]
GeneIDi818311
GrameneiAT2G37340.1; AT2G37340.1; AT2G37340 [Q8VYA5-1]
AT2G37340.2; AT2G37340.2; AT2G37340 [Q8VYA5-2]
AT2G37340.3; AT2G37340.3; AT2G37340 [Q8VYA5-3]
AT2G37340.4; AT2G37340.4; AT2G37340 [Q8VYA5-2]
AT2G37340.5; AT2G37340.5; AT2G37340 [Q8VYA5-3]
AT2G37340.6; AT2G37340.6; AT2G37340 [Q8VYA5-2]
KEGGiath:AT2G37340

Organism-specific databases

AraportiAT2G37340
TAIRilocus:2049766, AT2G37340

Phylogenomic databases

eggNOGiKOG0107, Eukaryota
HOGENOMiCLU_047187_3_0_1
InParanoidiQ8VYA5
OMAiKCATHGG
PhylomeDBiQ8VYA5

Miscellaneous databases

Protein Ontology

More...PROi		PR:Q8VYA5

Gene expression databases

ExpressionAtlasiQ8VYA5, baseline and differential
GenevisibleiQ8VYA5, AT

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR000504, RRM_dom
IPR001878, Znf_CCHC
IPR036875, Znf_CCHC_sf
PfamiView protein in Pfam
PF00076, RRM_1, 1 hit
PF00098, zf-CCHC, 2 hits
SMARTiView protein in SMART
SM00360, RRM, 1 hit
SM00343, ZnF_C2HC, 2 hits
SUPFAMiSSF54928, SSF54928, 1 hit
SSF57756, SSF57756, 1 hit
PROSITEiView protein in PROSITE
PS50102, RRM, 1 hit
PS50158, ZF_CCHC, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRSZ33_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8VYA5
Secondary accession number(s): F4IQ37
, Q67Y02, Q9FYA7, Q9ZUT2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2012
Last sequence update: March 1, 2002
Last modified: September 29, 2021
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again