UniProtKB - Q8VL32 (Q8VL32_ENTFL)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>tr|Q8VL32|Q8VL32_ENTFL Cro/Cl family transcriptional regulator OS=Enterococcus faecalis OX=1351 GN=cylR2 PE=1 SV=1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDI FQWQPE
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Cro/Cl family transcriptional regulator
cylR2
Annotation score:1 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- sequence-specific DNA binding Source: InterPro
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Submitted name: Cro/Cl family transcriptional regulatorImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Submitted name: CylR2Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Submitted name: Putative transcription regulatorImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Submitted name: Transcriptional regulatorImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:cylR2Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi ORF Names:A6B47_00845Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , BZG32_02305Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , CUN08_03990Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , ELS84_2076Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates if the gene coding for the protein originates from the hydrogenosome, the mitochondrion, the nucleomorph, different plastids or a plasmid. The absence of this section means that the gene is located in one of the main chromosomal element(s).<p><a href='/help/encoded_on' target='_top'>More...</a></p>Encoded oni | Plasmid pAD1Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Enterococcus faecalis (Streptococcus faecalis)Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 1351 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Bacteria › Terrabacteria group › Firmicutes › Bacilli › Lactobacillales › Enterococcaceae › Enterococcus |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
Protein-protein interaction databases
Database of interacting proteins More...DIPi | DIP-61746N |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 6 – 60 | HTH cro/C1-typeInterPro annotation <p>Information which has been generated by the UniProtKB automatic annotation system, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000259">More...</a></p> Automatic assertion inferred from signature matchi Add BLAST | 55 |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4105VZ8 Bacteria COG1476 LUCA |
Family and domain databases
Conserved Domains Database More...CDDi | cd00093 HTH_XRE, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001387 Cro/C1-type_HTH IPR010982 Lambda_DNA-bd_dom_sf |
Pfam protein domain database More...Pfami | View protein in Pfam PF01381 HTH_3, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00530 HTH_XRE, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF47413 SSF47413, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS50943 HTH_CROC1, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
10 20 30 40 50
MIINNLKLIR EKKKISQSEL AALLEVSRQT INGIEKNKYN PSLQLALKIA
60
YYLNTPLEDI FQWQPE
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AH011360 Genomic DNA Translation: AAL59476.1 AF394225 Genomic DNA Translation: AAL60140.1 CP019512 Genomic DNA Translation: AQL52608.1 CP015883 Genomic DNA Translation: ARV02495.1 MSQH01000021 Genomic DNA Translation: OSH08405.1 PTVE01000019 Genomic DNA Translation: PQC72154.1 |
NCBI Reference Sequences More...RefSeqi | WP_002358483.1, NZ_PUAF01000003.1 |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q8VL32 | DNA-binding helix-turn-helix protein | 66 | |||
| CylR2 | 66 | ||||
| Transcriptional regulator | 66 | ||||
| CylR2 | 66 | ||||
| DNA-binding helix-turn-helix protein | 66 | ||||
| +3 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q8VL32 | DNA-binding helix-turn-helix protein | 66 | |||
| CylR2 | 66 | ||||
| Transcriptional regulator | 66 | ||||
| CylR2 | 66 | ||||
| DNA-binding helix-turn-helix protein | 66 | ||||
| +7 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q8VL32 | Uncharacterized HTH-type transcriptional regulator MJ0272 | 66 | |||
| Transcriptional regulator, XRE family | 67 | ||||
| Transcriptional regulator, XRE family | 66 | ||||
| Transcriptional regulator, XRE family | 66 | ||||
| Cro/Cl family transcriptional regulator | 67 | ||||
| +715 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AH011360 Genomic DNA Translation: AAL59476.1 AF394225 Genomic DNA Translation: AAL60140.1 CP019512 Genomic DNA Translation: AQL52608.1 CP015883 Genomic DNA Translation: ARV02495.1 MSQH01000021 Genomic DNA Translation: OSH08405.1 PTVE01000019 Genomic DNA Translation: PQC72154.1 |
NCBI Reference Sequences More...RefSeqi | WP_002358483.1, NZ_PUAF01000003.1 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1UTX | X-ray | 1.90 | A/B | 1-66 | [»] | |
| 2GZU | NMR | - | A/B | 1-66 | [»] | |
| 2LYJ | NMR | - | A/B | 1-66 | [»] | |
| 2LYK | NMR | - | A/B | 1-66 | [»] | |
| 2LYL | NMR | - | A/B | 1-66 | [»] | |
| 2LYP | NMR | - | A | 1-66 | [»] | |
| 2LYQ | NMR | - | A | 1-66 | [»] | |
| 2LYR | NMR | - | A | 1-66 | [»] | |
| 2LYS | NMR | - | A | 1-66 | [»] | |
| 2XI8 | X-ray | 1.21 | A/B | 1-66 | [»] | |
| 2XIU | X-ray | 1.50 | A/B | 1-66 | [»] | |
| 2XJ3 | X-ray | 1.23 | A/B | 1-66 | [»] | |
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
Database of interacting proteins More...DIPi | DIP-61746N |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | ENOG4105VZ8 Bacteria COG1476 LUCA |
Family and domain databases
Conserved Domains Database More...CDDi | cd00093 HTH_XRE, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001387 Cro/C1-type_HTH IPR010982 Lambda_DNA-bd_dom_sf |
Pfam protein domain database More...Pfami | View protein in Pfam PF01381 HTH_3, 1 hit |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00530 HTH_XRE, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF47413 SSF47413, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS50943 HTH_CROC1, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | Q8VL32_ENTFL | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q8VL32Primary (citable) accession number: Q8VL32 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/TrEMBL: | March 1, 2002 |
| Last sequence update: | March 1, 2002 | |
| Last modified: | July 18, 2018 | |
| This is version 91 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Unreviewed (UniProtKB/TrEMBL) | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structureCombined sources<p>Information inferred from a combination of experimental and computational evidence, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000213">More...</a></p> Automatic assertion inferred from combination of experimental and computational evidencei
, Complete proteomeImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi
, PlasmidImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi
